6NJ5A

Thermostable variant of human carbonic anhydrase ii with disordered tetrazine 2.0 at site 233
Total Genus 74

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
Knots found
sequence length
265
structure length
264
Chain Sequence
AHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHTFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSHDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSANPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVSKFRKLNFNGGEPEEPMVDNWRPTQPLKNRQIKASFKHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TI1 (7-10)3H1 (12-18)TIV1 (8-11)3H2 (20-23)TIV2 (24-27)TVIa1 (199-202)TII'2 (250-253)TI2 (34-37)TIV3 (33-36)TIV7 (107-110)TI7 (261-264)EMPTYS2 (38-39)S3 (44-49)TI3 (40-43)TI4 (50-53)S9 (115-123)S4 (55-60)TIV4 (61-64)3H5 (163-165)S7 (86-96)S6 (77-81)TII'1 (80-83)3H3 (124-127)TI6 (136-139)TI5 (99-102)TIV6 (104-107)S12 (190-195)S8 (107-108)TI'1 (108-111)S13 (206-211)3H4 (154-156)AH3 (219-226)AH2 (157-161)3H6 (180-183)S15 (256-257)TIV9 (231-235)S1 (31-32)TII1 (168-171)S5 (65-69)TVIII2 (74-77)TIV5 (97-100)AH1 (130-134)S10 (140-149)S14 (215-217)TIV8 (175-178)S11 (171-177)Updating...
connected with : NaN
molecule tags Lyase
source organism Homo sapiens
publication title Genetic code expansion of thermostable carbonic anhydrase II to create ideal platform for bioorthogonal ligating industrial useful enzymes to synthetic polymers
rcsb
molecule keywords Carbonic anhydrase 2
total genus 74
structure length 264
sequence length 265
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2019-01-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.