6PEPAM

Focussed refinement of invgn0n1:spapqr:prgij from the salmonella spi-1 injectisome needle complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
39
structure length
39
Chain Sequence
DPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Surface presentation of antigens protein SpaP
publication title T3S injectisome needle complex structures in four distinct states reveal the basis of membrane coupling and assembly.
pubmed doi rcsb
total genus 18
structure length 39
sequence length 39
chains with identical sequence AN, AO, AP, AQ, AR
ec nomenclature
pdb deposition date 2019-06-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...