6QD8A

Em structure of a ebov-gp bound to 4m0368 neutralizing antibody
Total Genus 43

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
Knots found
sequence length
289
structure length
256
Chain Sequence
SIPLGVIHNSALQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTTSEELSFTVVXXXXXXXXX

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI2 (154-157)S1 (35-39)S9 (151-154)TIV1 (38-41)S2 (42-46)TIV4 (50-53)TIV5 (52-55)TIV6 (53-56)AH1 (79-84)S8 (135-144)S5 (96-98)S6 (101-102)S7 (105-114)TI1 (115-118)TII1 (126-129)O1 (147-149)S10 (159-162)TII3 (171-174)TI3 (237-240)AH2 (250-263)TII4 (224-227)S14 (231-237)S15 (240-243)3H2 (70-73)S3 (63-69)S12 (177-185)TIV7 (195-198)TIV9 (227-230)TI4 (245-248)S4 (86-89)TIV3 (46-49)S13 (216-223)Updating...
connected with : NaN
molecule tags Viral protein
source organism Homo sapiens
publication title rVSV-ZEBOV induces a polyclonal and convergent B cell response with potent Ebola virus-neutralizing antibodies
rcsb
molecule keywords Light chain
total genus 43
structure length 256
sequence length 289
chains with identical sequence C, E
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2019-01-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.