6QOWA

Crystal structure of trmd, a trna-(n1g37) methyltransferase, from mycobacterium abscessus in complex with fragment 26 (6-methoxybenzothiazole-2-carboxylic acid)
Total Genus 55

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
229
structure length
213
Chain Sequence
GSMKIDVVTIFPEYLQPVRQSLPGKAIDAGLVDVAVHDLRRWTHDVHKSVDDSPYGGGPGMVMKPTVWGDALDEICTSETLLVVPTPAGYPFTQETAWQWSTEDHLVIACGRYEGIDQRVADDAATRMRVREVSIGDYVLNGGEAAALVIIEAVLRLVPGVLSLLEGPSYTRPPSWRGMDVPPVLLSGDHAKIAAWRAEQSRQRTIERRPDLL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (1-7)EMPTYTIV1 (7-10)TII'1 (110-113)3H1 (10-13)AH6 (141-154)AH1 (14-19)AH2 (22-27)3H2 (37-40)TI1 (43-46)AH3 (63-73)S3 (49-50)TII1 (52-55)S4 (60-61)AH5 (116-123)S5 (79-83)S8 (127-132)TI3 (84-87)O1 (134-136)S6 (88-89)AH4 (92-99)S7 (103-107)TVIII2 (187-190)S9 (189-190)TIV3 (189-192)3H3 (197-200)AH7 (204-222)S2 (30-36)TI2 (75-78)TIV2 (123-126)TII2 (156-159)S10 (193-194)TVIII1 (101-104)Updating...
connected with : NaN
molecule tags Transferase
source organism Mycobacterium abscessus
publication title Crystal structure of TrmD, a tRNA-(N1G37) methyltransferase, from Mycobacterium abscessus
rcsb
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
total genus 55
structure length 213
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-02-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.