6UGOA

Human carbonic anhydrase ix-mimic complexed with sb4-205
Total Genus 76

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVTFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTEGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
3H1 (13-18)EMPTYTIV1 (9-12)TI1 (8-11)TVIII1 (18-21)3H2 (21-24)TIV8 (241-244)AH1 (131-135)S13 (191-196)TIV2 (25-28)TVIa1 (200-203)S8 (108-109)S1 (32-33)TIV5 (105-108)S2 (39-40)TI3 (35-38)TI4 (41-44)TIV9 (251-254)S6 (78-82)S3 (45-50)TVIII2 (75-78)TIV4 (72-75)TI5 (51-54)S10 (116-124)TII1 (169-172)S4 (56-61)AH2 (158-163)AH3 (220-227)S5 (66-70)S7 (87-97)TII'1 (81-84)TVIII3 (98-101)TI6 (100-103)TIV6 (108-111)3H3 (125-128)TI7 (137-140)3H6 (181-184)S11 (141-150)S15 (216-218)3H5 (164-166)S12 (172-178)TIV7 (176-179)TII2 (233-236)TI2 (34-37)TIV3 (62-65)S9 (112-113)3H4 (155-157)S14 (207-212)Updating...
connected with : NaN
molecule tags Lyase/lyase inhibitor
source organism Homo sapiens
publication title "A Sweet Combination": Developing saccharin and acesulfame K structures for selectively targeting the tumor-associated carbonic anhydrases IX and XII.
pubmed doi rcsb
molecule keywords Carbonic anhydrase IX-mimic
total genus 76
structure length 257
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2019-09-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.