6XY6A

Structural insight into sheep-pox virus mediated inhibition of apoptosis
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
135
structure length
135
Chain Sequence
NYNIEKVLNVYLRDLRIESLNNNELEILIMIRECCEVIKKDYKTEFNEICNFILQNNVKSCYDINDVKNIIIETINSDFRPSVILASISLLSIIIKKKKDENNEVVDDDLALNELINKFSSYQKDIISFVEKNKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords anti-apoptotic membrane protein
publication title Crystal structures of the sheeppox virus encoded inhibitor of apoptosis SPPV14 bound to the proapoptotic BH3 peptides Hrk and Bax.
pubmed doi rcsb
source organism Sheeppox virus (strain turkey/tu-v02127)
total genus 47
structure length 135
sequence length 135
chains with identical sequence G
ec nomenclature
pdb deposition date 2020-01-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...