6YOAA

Lig v 1 structure and the inflammatory response to the ole e 1 protein family
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
138
structure length
138
Chain Sequence
VSQFYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIERDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNGTTRTINPLGFFKKEALPKCPQVFNKLGMYPPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lig v 1 structure and the inflammatory response to the Ole e 1 protein family.
pubmed doi rcsb
molecule tags Allergen
source organism Ligustrum vulgare
molecule keywords Major pollen allergen Lig v 1
total genus 31
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2020-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01190 Pollen_Ole_e_1 Pollen protein Ole e 1 like
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...