7B1KA

Crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
200
structure length
200
Chain Sequence
MFSIRKIITISDYVTMLNIITGLLAILLNSFSLIYLSIIFDSLDGYVARKTGTVSDFGAELDSISDVVSFGVAPAYLLYNNFESNLALISAIIFCLCGALRLARFGILNVKGFIGLPIPAGALLLVGFCQLINSYLINSILAILIGLLMISDIKYPKYPNKIFIYIFAVSLCLAIVGIPHFALMLCLIYAIYGIIKYIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords CDP-diacylglycerol--serine O-phosphatidyltransferase
publication title Crystal structures of phosphatidyl serine synthase PSS reveal the catalytic mechanism of CDP-DAG alcohol O-phosphatidyl transferases
doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045 / nbrc 100440)
total genus 79
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature ec 2.7.8.8: CDP-diacylglycerol--serine O-phosphatidyltransferase.
pdb deposition date 2020-11-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...