7BGUA

Mason-pfizer monkey virus protease mutant c7a/d26n/c106a in complex with peptidomimetic inhibitor
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
106
Chain Sequence
WVQPITAQKPSLTLWLDDKMFTGLINTGADVTIIKLEDWPPNWPITDTLTNLRGISNNPKQSSKYLTWRDKENNSGLIKPFVIPNLPVNLWGRDLLSQMKIMMASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Gag-Pro-Pol polyprotein
publication title Crystal structures of inhibitor complexes of M-PMV protease with visible flap loops.
pubmed doi rcsb
source organism Mason-pfizer monkey virus
total genus 23
structure length 106
sequence length 108
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.-:
pdb deposition date 2021-01-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...