7MY7AAA

Se-crte n-term his-tag structure
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
291
structure length
275
Chain Sequence
FDLKSYLKERQRQVEAALNAILPPQDPPLIYESMRYSLLAEGKRLRPILCLASCELAGGTAAIALPTACALEMVHTMSLIHDDLPSMDNDDFRRGRPTNHKVYGEDIAILAGDALLTYAFEAIARHTPEVPADRVLKVIAALARAVGAEGLVGGQVVDLQSEGRDDVNLETLHYIHTHKTGALLEVSVVSGAILAGASEELQEQLRTYAQKIGLAFQVIDDILDITKKATYPSLLGLDASREYADQLITEAKAAIAAFGAEADPLRAIADYITAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyl-diphosphate synthase
publication title Molecular characterization of cyanobacterial short-chain prenyltransferases and discovery of a novel GGPP phosphatase.
pubmed doi rcsb
source organism Synechococcus elongatus (strain pcc 7942 / fachb-805)
total genus 110
structure length 275
sequence length 291
chains with identical sequence BBB, CCC, DDD
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2021-05-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...