7MYQA

Crystal structure of a trna (guanine-n1)-methyltransferase from acinetobacter baumannii
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
245
structure length
229
Chain Sequence
HVFFAVITLFPEMFDAITAYGISGRAAKRDIVQVTCINPRDFAEGNYRRVDERPFGGGPGMVMMAEPLAKAINHAKQLASRAGCVHVPVVYMSPQGKTLNEQAVQQFVDYDGLIVLCGRYEGVDERLIQHYVDQEWSIGDYVLSGGELPAMVLLDSIIRRLPNVDGLLDCPQYTKPDQFEGLDVPEIGHHANIEKWRFLQRYQRTLERRPELIEQVTLTKQQKKWLSDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a tRNA (guanine-N1)-methyltransferase from Acinetobacter baumannii
rcsb
molecule tags Transferase
source organism Acinetobacter baumannii
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
total genus 64
structure length 229
sequence length 245
chains with identical sequence B
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2021-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...