7OPZA

Camel gstm1-1 in complex with glutathione
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
217
structure length
216
Chain Sequence
PMILGYWDIRGLAHAIRLLLEYTGSDYEEKIYSMGDAPDYDRSQWLSEKFKLGLDFPNLPYLIDGAHRLTQSNAILRYIARKHNLGETEEEKIRVDVLENQAMDTRLDFARVCYNPDFEKLKPGFLKEIPEKMKLFSEFLGKRTWFAGDKLNYVDFLAYDVLDVYRIFEPKCLDEFPNLKDFMSRFEGLKKISAYMKSSRFLRSPLFLKMAMWGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutathione transferase
publication title Structural and Functional Characterization of Camelus dromedarius Glutathione Transferase M1-1.
pubmed doi rcsb
source organism Camelus dromedarius
total genus 75
structure length 216
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: glutathione transferase.
pdb deposition date 2021-06-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...