7PQ3AAA

Crystal structure of the ring nuclease 0811 from sulfolobus islandicus (sis0811) in complex with its post-catalytic reaction product
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
268
structure length
268
Chain Sequence
MNKVHVSAVGTSLLKNSLSADNVKKEVEDLGLKDWDRLKFDDDRQNKIRDNFTTLKDLLLNFLKSKGKEASAELDSLLSAIEKLQHKKEELYVFLYTTNTWNSKLAGEVIKNYLEEEGIKSELATVKSISSEETFHEGIEDLFDKVIYKILKFKEEGKEVYINATAGLKPETTFLTLAGLLAGADLVYYKYQEFNDVVFLPSPPITISPRYLEWLIEFANYGYTLSEKKAEELGIPVRLLEVRNLVERKGEDAYRLKDWVRKMLGIYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antiviral protein
molecule keywords CRISPR-associated protein, APE2256 family
publication title Structural basis of cyclic oligoadenylate degradation by ancillary Type III CRISPR-Cas ring nucleases.
pubmed doi rcsb
source organism Sulfolobus islandicus rey15a
total genus 80
structure length 268
sequence length 268
chains with identical sequence BBB
ec nomenclature
pdb deposition date 2021-09-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...