7Q0Fq

Structure of candida albicans 80s ribosome in complex with phyllanthoside
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
190
structure length
190
Chain Sequence
MKYIQTDQILDIPEGVTVDIKARVVKVTGPRGELTKDLKHIDVTFNKINNRAIKITVHNGDRKHVAALRTVKSLIANLITGVTKGYKYKMRFVYAHFPINVNIIKKDGQDYVEIRNFLGEKRVREVKIHEGVTMEISSTQKDELIVSGNSLEAVSQNAADIQQICRVRNKDIRKFLDGIYVSERGTIVEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 25S ribosomal RNA
publication title E-site drug specificity of the human pathogen Candida albicans ribosome.
pubmed doi rcsb
total genus 36
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2021-10-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...