7RCZA

Crystal structure of c. difficile spovd in complex with ampicillin
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
530
structure length
511
Chain Sequence
EPKRGTIYDRNMKELAVSVTKYTVWCKPVEVEDKKEAAEKVAEILDEDYKDIYALISKKNMALVKVKRWIDDDKASQIRDAKLSGIWVAEDNQRYYPYGNFAPYVLGHTSSDATGISGVEMQYDKKLKGKPGKLEPVQGNGLVLSIDEVIQHYTEKAVQKAYELNNAKKVTAIAMNPKTGDILALASKPDYDPNDSRTPIYPYYQEELEKYNDKDKIKGYYQMWRNPAVSDTYEPGSTFKLITSSSALEEGVIKDGEKFTCTGSVTVGGRKIKCWRHYRPHGTQEFKQAVQNSCNPVFVELGSRLGVGKMYDYIESFGLMDKTGIDLPGEAKGILYNEKNVGPVELATISFGQSISVTPIQLITAISSIANGGDLMQPRVVKSYTDNKGNITETVKPKKVRSVISKETSKKMLEIAESVVTEGGGKIAYIPGYRLGGKTGTAQKVIDGKYAPGKYICSFVGIAPCDDPQIVVLAIVDEPTGVSAFGSTTAGPIVKEIMNDSLKYLGVKPVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords Stage V sporulation protein D (Sporulation specific penicillin-binding protein)
publication title A unique class of Zn 2+ -binding serine-based PBPs underlies cephalosporin resistance and sporogenesis in Clostridioides difficile.
pubmed doi rcsb
source organism Clostridioides difficile (strain r20291)
total genus 163
structure length 511
sequence length 530
chains with identical sequence B
ec nomenclature
pdb deposition date 2021-07-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...