7UUWG

Cryogenic electron microscopy 3d map of f-actin bound by the actin binding domain of alpha-catenin ortholog, hmp1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
185
structure length
159
Chain Sequence
IQAQIDIFKVKWDETGNDIISLANNMCKIMMSMTEFTRGCGPLKTTMDVIRAAQEISLNGSKLNALARQIGEESADSQTKKDLLAYLSQITLYCQQLNICSKVKADVTQVGALDSAMSLIQTARNLLTAVVQTVKAAYIASTKFRWRMAPPKKQPLIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Actin, alpha skeletal muscle
publication title The nematode alpha-catenin ortholog, HMP1, has an extended alpha-helix when bound to actin filaments.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 56
structure length 159
sequence length 185
chains with identical sequence H, I, K, L, Z
ec nomenclature
pdb deposition date 2022-04-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...