7XC6E

Photobacterium phosphoreum fatty acid reductase complex luxc-luxe
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
325
structure length
118
Chain Sequence
DEQERIKHKLILESFRYHYNNNEDYKSFCNTQGVDENISSLDDIPVFPTSMFKYAKICTPPWVYARALDPVTLKPVEDGQEGLISYMDASSTSYPTFIVTDDIGIIHTTTIDIVRRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords LuxE
publication title Cryo-EM structure of the fatty acid reductase LuxC-LuxE complex provides insights into bacterial bioluminescence.
pubmed doi rcsb
source organism Photobacterium phosphoreum
total genus 24
structure length 118
sequence length 325
ec nomenclature
pdb deposition date 2022-03-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...