7Y1UA

Crystal structure of isocitrate dehydrogenase from campylobacter corcagiensis
Total Genus 275
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
275
sequence length
723
structure length
723
Chain Sequence
MIIYTYTDEAPALATYSLYPIIKHFLEKASIDITTADISLAGRILANFPEYLNEDQKVKDYLQILGELTKKSDANIIKLPNISASLPQLLDCIKELQDKGFKVPNYPNEPKDEKERLIKERYAKILGSAVNPVLREGNSIRRAAGAVKEYAKANPHSNGVWNKNTKTKVCYMDGGDFYSNEKSKIFENSTNLEVEFIPKNGDKKLLKELNIQAGEVVDATFMSAKKLDEFIAKSIDLAKDESLLYSVHLKATMMKVSDPVIFGHFVKGFFDEVFTEFQGELKALGVNPNNGLGDLFIKIENSKLKDKILAKFDEIYASRPSLSMVNSDKGITNLHVPSDVIIDASMPAMLRNSGRLWDKDAKEVEALAVIPDKSYAVVYEAMIKDLKENGTLDPSQIGSVTNIGLMAKKAEEYGSHDKTFIIESDGQIIVNDSNGEEIFRFEVEKGDIFRMTQTKSEPIKNWVKLAFDRAKLTGEKAIFWLDEKRAHDRNLIMLVKDELKKYDLKGFDYEILDPFSATLKTNQTIREGKNIISVTGNVLRDYLTDLYPILELGTSAKMLSIVPLLNGGGMFETGAGGSAPKHVEQLVSENHLRWDSLGEFMALIVSLEHLGTQNAKILAKALDKAVSRFLKEDKSPKRRAGEPDNRNSHFYLAMYFADELTKTELGNIYSDLALNLKNNEAKINDELLSVQGKSVDLGGYYKFDDEKASLVMRPSKTLNDIIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Isocitrate dehydrogenase [NADP]
publication title Crystal structure of isocitrate dehydrogenase from Campylobacter corcagiensis
rcsb
source organism Campylobacter corcagiensis
total genus 275
structure length 723
sequence length 723
ec nomenclature ec 1.1.1.42: isocitrate dehydrogenase (NADP(+)).
pdb deposition date 2022-06-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...