7ZYAA

Structure of chit33 from trichoderma harzianum.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
303
structure length
303
Chain Sequence
AGWNVNSKQNIAVYWGQNSANSQSTQQRLSFYCNDANINVIDIAFLNGITPPMTNFANAGDRCTPFSDNPWLLQCPEIEADIKTCQANGKTILLSLGGDSYTQGGWSSTGAAQSAADQVWAMFGPVQSGSSVHRPFGSAVVDGFDFDFEATTNNLAAFGAQLKSRTNAAGGKKYYFSAAPQCFFPDAAVGALINAVPMDWIQIQFYNNPCGVSGFTPGTSTQNNYNYQTWENWAKTSPNPNVKLLVGIPAGPGAGRGYVSGSQLTSVFQYSKGFSTFAGAMMWDMSQLYQNTGFETQVVNALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endochitinase 33
publication title Structure-Function Insights into the Fungal Endo -Chitinase Chit33 Depict its Mechanism on Chitinous Material.
pubmed doi rcsb
source organism Trichoderma harzianum
total genus 107
structure length 303
sequence length 303
ec nomenclature ec 3.2.1.14: chitinase.
pdb deposition date 2022-05-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...