8AVKA

Superoxide dismutase sodfm1 from cpr parkubacteria wolfebacteria
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
202
structure length
202
Chain Sequence
KHELPPLPYAYNALEPFIDAKTLEIHHTKHHQSYVDKLNAALEKYPDLQDKTVEELIKSLNELPEEIRTTVRNNAGGHFSHTLYWNIMNPATQEYIPEELGNALVETFGSIIAFKEQFSKAAANIFGSGWVWLAADANKKLKIVSTTGHDNPLMTGDAPLMVIDIWEHAYYLHYQNRRPEYIENWWNVLDWKAVEERYNALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
publication title An ancient metalloenzyme evolves through metal preference modulation.
pubmed doi rcsb
source organism Candidatus wolfebacteria bacterium gw2011_gwb1_47_1
total genus 77
structure length 202
sequence length 202
chains with identical sequence B
ec nomenclature ec 1.15.1.1: superoxide dismutase.
pdb deposition date 2022-08-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...