8B8IA

Nanobody (nblumsyt1) bound to human syt1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
MEVQLVESGGGLVQTGGSLRLSCTASGSIGSISVMGWYRQVPGTQYELVAGISRGGSTWYEDSVKGRFTISRDNAKNTLYLQMNSLKPEDTGMYYCAGGDYSDRLGSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords Nanobody (NbLumSyt1)
publication title Nanobody (NbLumSyt1) bound to human Syt1
rcsb
source organism Vicugna pacos
total genus 31
structure length 118
sequence length 118
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2022-10-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...