8BBJC

Secretagogin (mouse) in complex with its target peptide from syntaxin-4
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
183
structure length
181
Chain Sequence
DENFLLFFRLETPLDNSVEFMQIWRKYDADSSGFISAAELCNFLRDLFLHHKKNISEAELEEYTSTMMKIFDKNKDGRLDLNDLARILALQENFLLQFDASSTEERKRDFEKIFAHYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Peptide binding protein
molecule keywords Green fluorescent protein,Syntaxin-4
publication title Calcium binding protein in complex with its 2nd peptide ligand
rcsb
source organism Aequorea victoria
total genus 66
structure length 181
sequence length 183
chains with identical sequence D
ec nomenclature
pdb deposition date 2022-10-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...