8BT4A

Ribonucleotide reductase class ie r2 from mesoplasma florum, radical-lost ground state
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
345
structure length
312
Chain Sequence
GHMKNQYYNESVSPIEYAQQGFKGKMRSVNWNVVNDEKDLEVWNRITQNFWLPEKIPVSNDLTSWRTLTPEWQELITRTFTGLTLLDTIQATVGDVAQVPNSLTDHEQVIYTNFAFMVAVHARSGSIFSTLCSSEQIEEAHEWVINTETLQERAKALIPYYVNDDPLKSKVAAALMPGFLLYGGFYLPFYLSARGKLPNTSDIIRLILRDKVIHNYYSGYKYQKKVAKLSPEKQAEMKEFVFKLLYELIDLEKAYLKELYEDFGLADDAIRFSVYNAGKFLQNLGYDSPFTEEETRIEPEIFTQLSARAWEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ribonucleoside-diphosphate reductase
publication title Structure of a ribonucleotide reductase R2 protein radical.
pubmed doi rcsb
source organism Mesoplasma florum l1
total genus 135
structure length 312
sequence length 345
chains with identical sequence B
ec nomenclature ec 1.17.4.1: ribonucleoside-diphosphate reductase.
pdb deposition date 2022-11-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...