8CJBB

A268m variant of the codh/acs complex of c. hydrogenoformans
Total Genus 251
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
251
sequence length
730
structure length
730
Chain Sequence
INFDQIFEGAIEPGKEPKRLFKEVYEGAITATSYAEILLSRAIEKYGPDHPVGYPDTAYFLPVIRAFSGEEVRTLKDMVPILNRMRAQIKSELTFENARLAGEATWYAAEIIEALRYLKHTPENPIVVPPWTGFIGDPVVRQYGIKMVDWTIPGEAIIIGRAKDSKAAKKIVDDLMGKGLMLFLCDEIIEQLLEENVKLGVDYIAYPLGNFTQVVHAANYLLRAGLMFGGIAPGLRDAHRDYQRRRVLAFVLYLGEHDMVKTAMAMGAIFTGFPVITDQPLPEDKQIKDWFISEPDYDKIVQTALEVRGIKITSIDIDLPINFGPAFEGESIRKGDMHVEFGGGKTPSFELVRMVGPDEIEDGKVEVIGPDIDSVEPGGRLPIGIVVDIYGRKMQEDFEPVLERRIHYFTNYGEGFWHTAQRDLTWVRISKEAFAKGARLKHLGQLLYAKFKQEFPSIVDRVQVTIYTDEQKVLELREIARKKYAERDARLRELSDEAVDTYYSCLLCQSFAPTHVCIVSPERVGLCGAISWLDAKAAYEINPNGPNQPIPKEGLIDPVKGQWESFNEYIYKNSQRTIERMNLYTIMEYPMTSCGCFEAIMAYLPELNGFMIVNREHSGMTPIGMTFSTLAGMVGGGTQTPGFMGIGKSYIGSRKFVKADGGLARVVWMPKDLKEQLRSIIEERAEEEGLGRDFIDKIADETVGTTVDEVLPFLEEKGHPALSMEPLLRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Carbon monoxide dehydrogenase
publication title A225L variant of the CODH/ACS complex of C. hydrogenoformans
rcsb
source organism Carboxydothermus hydrogenoformans z-2901
total genus 251
structure length 730
sequence length 730
ec nomenclature ec 2.3.1.169: CO-methylating acetyl-CoA synthase.
pdb deposition date 2023-02-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...