8COZA

Structure of the catalytic domain of p. vivax sub1 (triclinic crystal form)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
340
structure length
335
Chain Sequence
KFNDEYRNLQWGLDLARLDETQDLINANRVSVTKICVIDSGIDYNHPDLRNNIDVNVKELHGRKGVDDDSNGVVDDVYGANFVSNSGDPMDDNYHGTHVSGIISAVGNNGIGIVGVDGHSKLVICKALDQHKLGRLGDMFKCIDYCISRQAHMISGSFSFDEYSNIFSASVEHLRSLGILFFVSASNCAHPDIAKCDLAVNHRYPPILSKTHNNVIAVANLKRDLDESYSLSVNSFYSNIYCQLAAPGTNIYSTTPMNNYRKLNGTSMASPHVAAIASIVRSINPNLTYLQIVEILRNAIVKLPSLTERVSWGGYVDILRAVNLAIDSKAAPYIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords subtilisin
publication title 3D structures of the Plasmodium vivax subtilisin-like drug target SUB1 reveal conformational changes to accommodate a substrate-derived alpha-ketoamide inhibitor.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 126
structure length 335
sequence length 340
chains with identical sequence B
ec nomenclature ec 3.4.21.62: subtilisin.
pdb deposition date 2023-03-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...