8CQSA

Flavin mononucleotide-dependent nitroreductase b.thetaiotaomicron (bt_0217)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
192
structure length
192
Chain Sequence
ADKVVKLPKPNLNRTGTVMKALSERQSTREYASKALTLADLSDLLWAANGINRSDAGKRTAPSAMNKQDVDVYVILSEGSYLYDAKNHQLNLIAEGDYRGAVAGGQAFVKTAPVSLVLISDVSRFGDAQKIQNQLMGAMDAGIVSQNISIFCSAAKLATVPRASMDAAQLKKVLKLKDSQIPMMNHPVGYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Nitroreductase-like protein
publication title Structural insights into the diversity of nitroreductase enzymes in Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
total genus 57
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-03-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...