8DHUA

Crystal structure of larp-dm15 from drosophila melanogaster bound to m7gpppc
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
151
structure length
148
Chain Sequence
QHPSHALLKENNFTQQAYHKYHSRCLKERRRLGYGQSQEMNTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIYQDFQDETIADYETGQLYGLEKFWAFLKYYKNLEVQPKLAEYLKSFKNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Comparative analysis of the LARP1 C-terminal DM15 region through Coelomate evolution
rcsb
molecule tags Rna binding protein
source organism Drosophila melanogaster
molecule keywords La-related protein 1
total genus 57
structure length 148
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2022-06-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...