8F0VA

Lipocalin-like milk protein-2 - e38a mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
155
structure length
155
Chain Sequence
KEPCPPENLQLTPRALVGKWYLRTTSPDIFKQVSNITAFYSAHGNDYYGTVTDYSPEYGLEAHRVNLTVSGRTLKFYMNDTHEYDSEYEILAVDKDYFIFYGHPPAAPSGLALIHYRQSCPKEDIIKRVKKSLKNVCLDYKYFGNDTSVHCRYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Milk protein
publication title Variability in phenylalanine side chain conformations facilitates broad substrate tolerance of fatty acid binding in cockroach milk proteins.
pubmed doi rcsb
source organism Diploptera punctata
total genus 32
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2022-11-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...