8G6EH

Structure of the plasmodium falciparum 20s proteasome complexed with inhibitor tdi-8304
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
252
structure length
246
Chain Sequence
TTIIGIIYDNGVMLACDSRTSSGTFISNKCSRKINRINENLYVCRSGASAHSQKIIEIIKHYCVSMKNENRKKGRFHEGETIDEEIDIDSINYLDYNNNNDNNLVTKNKYFYEDKFNDYNPLVENVAHITKKIIYTNNNFLSCALIFGGYDKIKKQQLYAVNLNGSIIEKHDFAVSGSGSIYIQSYLQDKYKKFMTKKECFNLILNCVKYAMHNDNSSGGLIRIVNITKSFVEEFTVVNTQMNFQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Proteasome subunit alpha type-6
publication title Structures revealing mechanisms of resistance and collateral sensitivity of Plasmodium proteasome inhibitors
rcsb
total genus 77
structure length 246
sequence length 252
chains with identical sequence V
ec nomenclature
pdb deposition date 2023-02-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...