8GDRD

Sars-cov2 s protein structure in complex with neutralizing monoclonal antibody 002-s21b10
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
216
structure length
216
Chain Sequence
QSALTQPASVSGSPEQSITISCSGTSRDIGGYNYVAWYQHHPGKAPKLMIYEVSNRPSGVSNRFSGSKSGNMASLTISGLQAEDKADYYCTSYTTGSTVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Spike glycoprotein
publication title Elucidating the mechanism of SARS-CoV-2 Omicron variant escape from a RBD class-3 human antibody
rcsb
source organism Severe acute respiratory syndrome coronavirus 2
total genus 33
structure length 216
sequence length 216
chains with identical sequence J
ec nomenclature
pdb deposition date 2023-03-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...