8HBIB

Fmdv (a/tur/14/98) in complex with m688f
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
207
structure length
207
Chain Sequence
DRTLTTRNGHTTSTTQSSVGVTYGYSTGEDHVSGPNTSGLETRVTQAERFFKKHLFNWTTDKPFGHLEKLKLPTDHKGVYGHLVDSFAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKKFTPREKYQLTLFPHQFISPRTNMTAHITVPYLGVNRYDQYKKHKPWTLVVMVVSPLTTSSIGATEIKVYANIAPTHVHVAGELPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Virus
molecule keywords M688F nab
publication title Structural and in vivo studies of neutralizing antibody topographical classifications reveal mechanisms underlying differences in immunogenicity and antigenicity between 146S and 12S of foot-and-mouth disease virus
rcsb
source organism Lama glama
total genus 33
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2022-10-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...