8IQAA

Crystal structure of pyruvic oxime dioxygenase (pod) from alcaligenes faecalis deleted n-terminal 18 residues
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
225
Chain Sequence
DTRETMAFACRILAMTEQEALAGQISVRSERPGAYWTLRFGLGFDEATPEDFIEVDRDLNTLSGEGMANPATRFHLWVYEARPDVNSIIHTHSPWATVLATARQPLVISQMDMTPLHNDCAFLGEWPGADQEGVIISKALGDKRAIILAHHGYLTAGKSCQEATYLSVYLERAARLQVRAQAAFGPLTPVDDTLAAEAHDYLLKPSIVNATFDYWSRQTQGIAPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Aldolase
publication title Structural and functional analysis of pyruvic oxime dioxygenase, a key enzyme of heterotrophic nitrification
rcsb
source organism Alcaligenes faecalis subsp. faecalis nbrc 13111
total genus 76
structure length 225
sequence length 229
chains with identical sequence B, C, D
ec nomenclature ec ?:
pdb deposition date 2023-03-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...