8JKZA

Cryo-em structure of the prokaryotic sparsa system complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
584
structure length
584
Chain Sequence
MDVLTDNEFYQHYLQNSQHMMWFLGAGTSRSAGLPTASDIIWDLKHRYYCLHENQDYQKHDINNHAIKSKIQSYMDSKGFPLQWSPEEYSFYFELVFRDDYEAQRKYLLEALASRKVSLNIGHRVLAALLEMNQTKVVFTTNFDDVIETAFSDISGKHLSVYHLEGSYAALSALNTEAFPIYAKIHGDFRYQKIKNLTPDLQTNDREIHKCFLAAAIRFGLVVSGYSGRDENVMTMLRAAIDQNNAFPHGLYWTVPSISKSEPAVQDLITYAQGKGVRAYLVETGTFDEMLSKIWRQVKDKPAAIDAKVRTARVCPVSIPLPGPGKSFPALRTNALPVVTQSIRCGVVTLASPITFSELKERISQKSPKALLTYTEKVLFLGGEPEIRKIFSNDEINSIGQYYIDEIAQSVAASTFLKSFVEEAILTALLREKPILHRVRHRTHYAVIPNASAKDDRFLDLRKAVGFKGDLGYITGNVTNAKELSWAEAVSIRLEERGGKLWIMLKPEIWIKPLDRREEATDFIRSRRRYRFNQCSYQILDAWIKILFGSIGGGGTVNISCFPDAEFKAEFEIGTRTAFSLGVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antiviral protein
molecule keywords Sir2 superfamily protein
publication title Structural basis of antiphage immunity generated by a prokaryotic Argonaute-associated SPARSA system.
pubmed doi rcsb
source organism Geobacter sulfurreducens
total genus 126
structure length 584
sequence length 584
ec nomenclature ec ?:
pdb deposition date 2023-06-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...