8JL8A

Crystal structure of the collagen binding domain of cnm from streptococcus mutans
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
296
structure length
291
Chain Sequence
QASDVSSNISSLTVSPTQINDGGKTTVRFEFDEHAQNIKAGDTITVNWQNSGTVRGTGYTKTIKLEVQGKYVGDLVVTQDKAVVTFNDSITGLQNITGWGEFEIEGRNFTDTTTGNTGSFQVTSGGKTAEVTVVKSAVFYYKTGDMQTDDTNHVRWFLNINNENAYVDSDIRIEDDIQSGQTLDIDSFDITVNGSESYHGQEGINQLAQRYGATISADPASGHISVYIPQGYASLNRFSIMYLTKVDNPDQKTFENNSKAWYKENGKDAVDGKEFNHSVANVNAAGGVDGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Collagen-binding adhesin
publication title Structure, Stability and Binding Properties of Collagen-Binding Domains from Streptococcus mutans.
doi rcsb
source organism Streptococcus mutans
total genus 77
structure length 291
sequence length 296
ec nomenclature
pdb deposition date 2023-06-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...