8JWDA

Histidine kinase qsee sensor domain of escherichia coli o157:h7
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
123
structure length
123
Chain Sequence
AALVNRTTLIDARRSEAMTNAALEMERSYRQYCVLDDPTLAKVYQSQRKRYSEMLDAHAGVLPDDKLYQALRQDLNNLAQLQCNNSGPDAAAAARLEAFASANTEMVQATRTVVFSRGQQLQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords histidine kinase
publication title Crystal structures of QseE and QseG: elements of a three-component system from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli o157:h7
total genus 56
structure length 123
sequence length 123
ec nomenclature ec 2.7.13.3: histidine kinase.
pdb deposition date 2023-06-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...