8OIEB

Iron nitrogenase complex from rhodobacter capsulatus
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
SEKLDPLVDYIMKNCLWQFNSRGWDRLKQNAGILSQTCEILCGEEPVHETAMDRCYWVDAVILSRAYKARFPWLMAMTKPEIKSLFKALHEKIDHLTVHGSLNTELTVPHY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Nitrogenase protein alpha chain
publication title Structural insights into the iron nitrogenase complex
doi rcsb
source organism Rhodobacter capsulatus sb 1003
total genus 41
structure length 111
sequence length 111
chains with identical sequence G
ec nomenclature ec 1.18.6.1: nitrogenase.
pdb deposition date 2023-03-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...