8ONMA

Crystal structure of d-amino acid aminotransferase from aminobacterium colombiense point mutant e113a complexed with d-glutamate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
276
structure length
276
Chain Sequence
HMNLCYIDGKFLPLEEAKLPVTDLIIQRGVGVFETISTHSRRPLMLTPHLKRLEGSATASSIVMPATLDEMARIIREGIKKMGCETMVRPYITGGDSFGKDHLFSSSRYFVIFAEIRKPDPILYEKGVALHPINAERYLPSTKSINYMLSFTGQRDSKGAYEILYCPEGEIVEGSHSTFFLIKNGHLITAPTSRALSGTTRQIVLELARRGNIQVEERCPLLTELPEAEEAFITGTVKELLPVVRIGDQIIGNGVPGKLTKHLHQVYLSSIVEWLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Aminotransferase class IV
publication title Probing of the structural and catalytic roles of the residues in the active site of transaminase from Aminobacterium colombiense
rcsb
source organism Aminobacterium colombiense
total genus 88
structure length 276
sequence length 276
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-04-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...