8OR7A

Structure of a far-red induced allophycocyanin from chroococcidiopsis thermalis sp. pcc 7203
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
158
structure length
158
Chain Sequence
GSIVTELILNADSESRYPAPKEIQVYQNFVKTGEQRIRIAKILAENEQRIVQNGSARFWERVPNTPSNSGNERKTASCQRDQGWYIRLIAYSVLAGSEKPLEEIGTIGIKEMYNNLEIPLRNIVECMRCLKEEALSLMSEEDALEVSAYFDYVMRSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Photosynthesis
molecule keywords Allophycocyanin beta subunit apoprotein
publication title Crystallographic and biochemical analyses of a far-red allophycocyanin to address the mechanism of the super-red-shift.
pubmed doi rcsb
source organism Chroococcidiopsis thermalis
total genus 66
structure length 158
sequence length 158
chains with identical sequence C
ec nomenclature ec ?:
pdb deposition date 2023-04-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...