8PHUAF

Asymmetric structure of the portal-containing cap of the borrelia bacteriophage bb1 procapsid
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
161
structure length
144
Chain Sequence
MKNPQHDASLLSNSNEFRDKNVEFFASGGTRTSKFDKLENHPFLGYPYKRGVKRVIQHYEPHVEAGGGEDLYGICIDIDEFSKTATIVPITNNFEGYLVAKDSTVKVKDKLIFNKDGALEKVATALTDAKQISNEVYLVKVAVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Major capsid protein
publication title Structure of the Borrelia Bacteriophage phi BB1 Procapsid.
pubmed doi rcsb
source organism Borreliella burgdorferi b31
total genus 26
structure length 144
sequence length 161
chains with identical sequence AN, AV, BE, BP, BY, CO, DF, DN, DV, EE, EP, EY, FO, GF, GN, GV, HE, HP, HY, IO, JF, JN, JV, KE, KP, KY, LO, MF, MN, MV, NE, NP, NY, OO
ec nomenclature
pdb deposition date 2023-06-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...