8PKHFK

Borrelia bacteriophage bb1 procapsid, fivefold-symmetrized outer shell
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
164
structure length
152
Chain Sequence
MKNPQHDASLLSNSNEFRDKNVEFFASGGTRTSKFDKLENHPFLGYPYKRGVKRVIQHYEPHVEAGGGEDLYGICIDIDEFSKTATIVPITNNFEGYLVAKDSTVKVKDKLIFNKDGALEKVKATINATALTDAKQISNEVYLVKVAVFGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Major capsid protein
publication title Structure of the Borrelia bacteriophage BB1 procapsid
rcsb
source organism Borreliella burgdorferi b31
total genus 24
structure length 152
sequence length 164
chains with identical sequence FL, FM, FN, FO, FP, FQ, FR, FS, FT, FU, FV, FW, FX, FY, FZ, GA, GB, GC, GD, GE, GF, GG, GH, GI, GJ
ec nomenclature
pdb deposition date 2023-06-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...