8QX5A

Helical carotenoid protein 4 (hcp4) from anabaena with bound canthaxanthin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
158
structure length
158
Chain Sequence
SQAFGIQTGDAVASTITVFQALSIDDQLAVLWYAYTEMGRSITPAATGAARLQLAEGLLNQIKQMSHAEQLQVMRDLAAKNNTQVSRSYGILSNNTKLAFWYELSELMVKGFVVPVPTDYKISRDGSQVLEALKGLDFGQQITVLRKVVADMGVDPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Photosynthesis
molecule keywords Orange carotenoid-binding domain-containing protein
publication title Insights into energy quenching mechanisms and carotenoid uptake by Orange carotenoid protein homologs: HCP4 and CTDH.
pubmed doi rcsb
source organism Cyanobacteriota
total genus 55
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-10-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...