8RBSA1

Emiliania huxleyi virus 201 (ehv-201) asymmetrical unit of capsid proteins predicted by alphafold2 fitted into the cryo-em density of ehv-201 virion composite map.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
482
structure length
482
Chain Sequence
AGSLTQLLATGSMDAALTQNATRTFWKSSYQKHSLFALESINQPFTTQVQFGAESHITVNRQGDLLSWMYLKIVLPGLKVQNQADTVQPTQQSFASLDNDVAAQADVSHVLPYIEGAYTEASLNTKEQLIAEAKNSYEAAKYNAAPLPVAAQMQSTEMPDFDYAYWTEAIGFHLIKRAEFKVGGATIDTIWSELLFAMEELMGRAGRRLTETIGRTLRRPTELMKASRQEQILYVPLPWYFTKHPSLAFPLVAATYHNIQLWVQWAQLNSCIIKSRSNLVVLHAERNVPISDDHLRASLECTYVHLEAAERDALTANAGTQLIVQHQAHLQQVSSNNVTARLNFNFPVLEFYYFLRRKANKDAGDHFNFSGIGGRDPVVSAELLFNNTARVTQKPAVWWRAVQALQFHSSAPLTNIYSYSFSLSPEDPITPSGSANFSRLDSVELALTLQDDFGAAHDANSELFVFARSYNILKFTNGLAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Virus
molecule keywords Major capsid protein
publication title Structure and replication cycle of a virus infecting climate-modulating alga Emiliania huxleyi.
rcsb
total genus 85
structure length 482
sequence length 482
chains with identical sequence A2, A3, A4, A5, A6, A7, A8, A9, B1, B2, B3, B4, B5, B6, B7, B8, B9, C1, C2, C3, C4, C5, C6, C7, C8, C9, D1, D2, D3, D4, D5, D6, D7, D8, D9, E1, E2, E3, E4, E5, E6, E7, E8, E9, F1, F2, F3, F4, F5, F6, F7, F8, F9, G1, G2, G3, G4, G5, G6, G7, G8, G9, H1, H2, H3, H4, H5, H6, H7, H8, H9, I1, I2, I3, I4, I5, I6, I7, I8, I9, J1, J2, J3
ec nomenclature
pdb deposition date 2023-12-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...