8SAJ1

Mycobacterium phage adjutor
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
ARYDKYNPYGGGFRAPLAADWTDADAGKLYAVGINNVGAVVKGAGQSGVAGVLVLTKGAKAGSIVDVMKFGEVVEFGPTSGTPGTDFGAAGTAYYADTSTGAINSTSGEAKVKVGHTVGAQRLIVAVADGVVDPSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Virus
molecule keywords Major capsid protein
publication title A novel accessory protein stabilizes the capsid of two actinobacteriophages
rcsb
total genus 27
structure length 137
sequence length 137
chains with identical sequence 2, 3, 4, 5, 6, 7
ec nomenclature
pdb deposition date 2023-04-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...