8SBHA

Yeie effector binding domain from e. coli
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
199
structure length
198
Chain Sequence
MIRIYASSTIGNYILPAVIARYRHDYPQLPIELSVGNSQDVMQAVLDFRVDIGFIEGPHSTEIISEPWLEDELVVFAAPTSPLARGPVTLEQLAAAPWILRERGSGTREIVDYLLLSHLPKFEMAMELGNSEAIKHAVRHGLGISCLSRRVIEDQLQAGTLSEVAVPLPRLMRTLWRIHHRQKHLSNALRRFLDYCDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Transcriptional regulator YeiE, LysR family
publication title FinR, a LysR-type transcriptional regulator involved in sulfur homeostasis with homologs in diverse microorganisms
rcsb
source organism Escherichia coli k-12
total genus 58
structure length 198
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-04-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...