8SM8A

Air-oxidized a. ca truffo expressed from m9 minimal medium supplemented with fe
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
344
structure length
344
Chain Sequence
HIIDTDVHESFASLKDLVPYLPEPYKSWIGNGAWRGFSQPFAYTSPGNGNRADVKSADGSASVSDYNLMRSQLLDPYKLSYAVLTGYFYPTGLKLQYGLGSALASAYNDYVLEHWISKDKRFLGSVQINARDPEAAAREIDRMAAHPQIRQVMLPVVDDIAYGHPMYRPIFAAAERNKLMVAFHHTTFAQGPYGMGLHYMERHCLIPISLMPQVISLIANGVFDSYPNLRFMVLEGGFSWLPHVMWRMDREYRQGRVEVPWIKKLPSQHCRERLRLSTQPTEDISGEDWGKLIDLMGTDDILVFSTDYPHFDFDDPNAAIPKSLSSGTRDKILWKNAADFYGLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Putative amidohydrolase
publication title Bioinformatic Discovery of a Cambialistic Monooxygenase.
pubmed doi rcsb
source organism Afipia carboxidovorans om5
total genus 125
structure length 344
sequence length 344
chains with identical sequence D, G, J
ec nomenclature ec ?:
pdb deposition date 2023-04-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...