8XEJH

Cryo-em structure of human xkr8-basigin complex in lipid nanodisc
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
214
structure length
209
Chain Sequence
ESVEESGGRLVTPGTPLTLTCTVSGFSLSDYAMNWVRQAPGKGLEWIGIIYASGSRYYASWAKGRFTISKTSTTVDLKITSPTTEDTATYFCARYYAGSDIWGPGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid transport
molecule keywords Isoform 2 of Basigin
publication title The role of the C-terminal tail region as a plug to regulate XKR8 lipid scramblase.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 209
sequence length 214
ec nomenclature
pdb deposition date 2023-12-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...