9AV7A

Crystal structure of cmgc family protein kinase from trichomonas vaginalis (amp-pnp)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
304
Chain Sequence
DELNYPLGNIDDYSVNNRIGRGKYSNVFSGHIIDSGKPIVVKVLKPVRIMKINREIAILNVLRNGPNISQLLDVVKDPDSKYISLILNYAENNDVKTLFGKMTTRDIALYIYGVLRALAFAHKNGIMHRDVKPGNIMWNQTTKEVSLIDWGLAEFYTPDSEYQVRVATKYYKGPELLLSYLKYTPSLDIWCLGCTLAGLLFHKLPFFKGRDSNEQIERMCVYLGGQAMLDYAEKYDLKLSSSLKARLSELKGTMWAGLINESNRDICTPQALDLLTKMLTIDHNLRPTAEQAMKHPFFDEIRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords non-specific serine/threonine protein kinase
publication title Crystal structure of CMGC family protein kinase from Trichomonas vaginalis (AMP-PNP)
rcsb
source organism Trichomonas vaginalis g3
total genus 94
structure length 304
sequence length 304
ec nomenclature ec 2.7.11.1: non-specific serine/threonine protein kinase.
pdb deposition date 2024-03-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...