1A0LA

Human beta-tryptase: a ring-like tetramer with active sites facing a central pore
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
244
structure length
244
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPTASE
publication title Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 1997-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a0lA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a0lA01
1HDTH 5C67A 1FONA 3ZVFA 1GHZA 4HI3A 3UNRA 2A4GA 1S84A 1TQ0B 3M5LA 1OWDA 2ZFQH 1GDUA 3PLBA 3KN2A 2CHAB 2GDEH 1ELGA 1YPKH 4OS4A 1V2PT 1CGJE 1CHOF 2PUQH 5BRRE 4MTBA 2ZFPH 3RXDA 4Y11E 1XX9A 3UWIA 4Y6DA 4ABBA 3SGQE 3PMBB 1EB2A 1DWDH 1KYNA 1C1NA 4ZXXH 2ZHFH 5GCHG 1DFPA 4CH8B 1LPZB 1SGIB 3A7TA 5HMAA 1QB1A 1XVOA 5JBCS 1MAXA 5EQSA 2PV9B 3BG8A 4AGKA 2O8UA 2ZDVH 1P2KA 3RC6A 1GMCG 1GHYH 3RXTA 3PO1C 4TY7A 1GI8B 5GIBA 1GI5A 2QXJA 3T28A 1ZOMA 1QA7A 1X7AC 3GY5A 1IQEA 1UO6A 2BQ7B 2V0BA 4XOJA 3P8OA 1QFKH 1P2OA 2D1JA 1G3EA 1ZYOA 1OKXA 4MPVA 1IAUA 1A0JA 3K6YA 2ZU3A 4JK5A 2F9UA 1O2KA 1F5RA 2BQWB 4X0WU 2QAAA 1G30B 3DHKH 1NRSH 1CU1A 3L6PA 2FWWA 3H7TA 5C1XA 2VIVA 1Z6EA 3QO6A 2IJOB 3T25A 1UHBA 2BY5X 5L30H 1DVAH 1W2KH 1ZMLA 2K1QA 4WXIA 3TK5A 1C2JA 4H6SB 4WXVA 3VB4A 2PKSB 1ZGVA 3A86A 2FI3E 5DPAA 3SU0A 4FXGH 3Q77A 3TJOA 3LH1A 2ZDNA 1JBUH 1P2NA 1PQ8A 1AI8H 3BTDE 3GCOA 3T5FH 3K2UA 1C2FA 5E2OA 1WBGB 2A7HA 2D26C 5ESTE 1O2NA 1HV7A 1N8OB 3UR6A 1GMHG 3ZZ3A 1YLCA 4IW4E 2GP9B 1MTNB 4R8TB 1S82A 1SMFE 1M9UA 1CA0B 3I77A 1Q2WA 1TYNA 3PWCA 2PHBA 2Z9GA 4RKJB 3C1KA 1BRCE 3MNBA 4I8KA 4VGCC 4MQAA 1FAKH 5JPMH 2PW8H 4IN1A 1OXGA 5DP4A 1UTQA 3GCTG 3SNCA 1NZQH 3F9GA 2A4QA 1DM4B 3MU4A 4AB9A 5CHAB 1V2NT 1U6QA 1ELCA 4Y7BA 1AGJA 1T8MA 1HBTH 1NPMA 2A32A 8KME2 1XMNB 3LOXA 2HALA 3AW0A 1C2EA 2VGCC 4DW2U 4ZMAH 1C2HA 1TPAE 4LOYH 4FU7A 2OBOA 2OINA 4I31A 3SJKA 5A8YA 3P70B 1VCPA 5DP3A 8GCHG 1AN1E 4ZKSU 1TNIA 1D3DB 3GY8A 3SUGA 4ABGA 2GKVE 1OS8A 1OPHB 4GPGA 1TLDA 4CHAB 1DWEH 2GTBA 2P16A 1YPJH 2FP7B 1VITF 3E16B 4ABHA 3PB1E 3VB7A 2CN0H 4K2YA 1WV7H 1XUJA 2OC8A 1O31A 3LGTA 3MU5A 4DGJA 2ZTXA 2ZZUH 1MTSA 2LNCA 5FPYA 2H1UA 4JYUH 4AFQA 2ODYB 2G51A 3MNSA 1XKBC 3GCNA 2VVCA 3RXQA 3RXRA 1MBMA 1BB0B 1GG6C 2BMGB 1JIMA 1KLIH 1FXYA 1O3CA 2I6SA 3UWJH 4CRFA 1NS3A 3BV9B 3M7UA 2VH0A 3SU2A 1GGDC 4NA9H 2A45B 5GCHF 1XUIA 2G00A 3AAUA 2SGPE 1V2UT 2Q6GA 1HYLA 1V2ST 1WTGH 1DSUA 4MPXA 2XBWA 2XXLA 1DANH 3HPTB 3VPKA 1XKAC 2IOTA 5C1YA 3UQVA 1GMCF 1PYTD 3SQHE 2BD9A 3FZDA 3BTHE 1EQ9A 4J2YB 3TK9A 1Z1JA 1L0ZA 4X6OA 2G4TA 3VB6A 2QA9E 1C5LH 1Z1IA 2A5AA 3OY5U 4ZUHA 3SNBA 1TABE 3RDZA 1LKAA 1DY8A 1HIAB 2FLRH 1EZQA 2JH5D 1IQIA 5HM9A 2C8YB 4OS7A 1V2LT 2QXGA 3V3MA 3RXPA 3RC5A 1S0RA 2HVXA 1O5DH 1Y5BT 2ANYA 2R0LA 1RIWB 3BIVH 1C5MD 5C2ZA 1SFIA 3KIDU 2ZHDA 1Y3YA 1NRRH 1GCTC 4D9QA 1XXFA 3SUFA 2G8TA 1ESTA 3MO3A 1QTFA 1HAIH 1V2TT 2CF9H 3RP2A 3ZVDA 1NM6A 1TA6A 1C5ZB 5A8XA 1TBQH 3TH3H 1NRPH 3MU8A 1CO7E 3L33A 3P95A 2WYGA 3BTQE 4M7GA 2EI7A 2AEIH 3M36A 1ELBA 5JDUB 4Y0ZE 1MCVA 4UFEH 2FX6A 2ZHWH 1GHVH 1OP0A 5EPNA 1BOQA 3UR9A 4ABDA 1JIRA 2UWPA 4BXSA 3SW2B 4RSPA 4X8SH 1L4ZA 1FN8A 1IQHA 4MVNA 1PPHE 4OS1A 1O3LA 4FU9A 1KXDA 4FUEA 1ZTLA 3QN7A 4I8GA 2ZCKP 2AIQA 4ZHLU 4X8UH 1TOMH 2KAIA 3O8DA 4JZIA 1FPHH 1GJ8B 1C5NH 1B7XB 1A5HA 3GY2A 1PJPA 1Y59T 3E90B 4H6TA 5DK1A 1G2MA 1O3IA 1TBRH 2FOGA 1YGCH 4K8BA 1S6FA 3MFJA 1QQUA 3Q00A 1HAVA 1PPZA 1LPGB 1W14U 1NU9A 2CGAA 3M37A 4KTCA 2CHAC 5DGJA 3M5MA 8GCHF 1GJ4H 3SBKA 1WQSA 1ZRBA 4BTTB 1CGIE 2O8LA 2AGGX 1QRZA 4BTIB 5F6MA 1XUGA 1GWAA 2FOEA 4XBDA 1C1TA 4KTSA 1Q3XA 1ZGIA 2AH4X 2ZO3H 4D8NA 1EOJA 3O8RA 4YZUA 4RKOB 1ZSJA 4Y71A 4UFFH 3SNEA 2BDGA 2SNVA 4Y79A 1QL7A 4CRGA 4AB8A 3A7VA 1KDQB 1N6XA 3I78A 1BUIA 4OGYA 1HAPH 2Z3EA 3D65E 5A8ZA 1HLTH 2STAE 4KTUA 1SHHB 2HGTH 4WJG2 3A89A 2GV7A 2RCEA 1W3CA 1AFQB 2THFB 2Y81A 1TGTA 4MNXA 3SZNA 4JCNA 4D9RA 1J17T 5GPIB 4U32A 2PKAA 5BPEA 1L1GA 1DICA 1ESAA 3T27A 1HJAB 3EQ0H 1TX7A 1QB6A 1MU6B 3F9FA 1GBLA 4X1QU 1C5PA 3F6UH 3BTME 1RFNA 1CHOG 4PROA 3MU0A 3K6ZA 3MYWA 3BG4B 1V2OT 2CF8H 3RMNH 2VIWA 2OC1A 4JK6A 1O39A 4I7YH 4B2BA 1BTZA 4XE4A 1XM1A 2HOBA 2O8TA 1CA8B 1INCA 3MOCA 2FYRA 1O2WA 2WPIS 3S9AA 4FUGA 3QZRA 1C1MA 1SGNE 2NU1E 1KLJH 3PWBA 2BD8A 2VJ1A 4MPUA 2ZNKH 1FY8E 1FZZA 4ABEA 1AZ8A 2Y6TA 1GHBF 2C8WB 4YOGA 1BRAA 1SGPE 2BD3A 3ENSB 1HAZB 3ATIA 3U1IB 2A4OA 1QJ6B 1VR1H 2ZTYA 3ZV9A 1B0EA 1YPGH 3VGCB 2Z7FE 2WUCA 1UTKA 1G3CA 3D23A 2GCTC 1S0QA 3A8AA 4U2WA 2G5VA 4GCHF 2FOFA 2BQ6B 1MTNC 2ZCHP 2ZGCA 1S83A 2Z9JA 3O8CA 1P57B 1FDPA 5CE1A 3STIA 1EP6A 1P2IA 3HK3B 5AFZH 4A1XA 2WPJS 1C1RA 2GGVB 1K2I1 3TNTA 4K5ZA 1C2MA 2ALPA 1GJAB 1THPB 4GUXA 3RC4A 5E8EH 1YPMH 4FUBA 3K65B 1C4Y2 1A3BH 5FHTA 1MCTA 3LT3A 1GBEA 1VJAU 1UCYH 3ZZ9A 1PYTC 2RDLA 3SGAE 2CV3A 1GI9B 1SGTA 2ZFRH 4B1TA 2O8WA 3UOUA 1C5QA 5AF9H 2FXRA 1S6HA 1OP2A 4ABFA 2XYAA 2QF0A 1E35B 3HGPA 1C1SA 2F9PA 2YOLA 2FIRH 1C4V2 5EOKA 2GV6A 4CHAC 3GOVB 1O2ZA 1ID5H 4YOIA 3S7KB 1HJ9A 2GD4B 1PPBH 1TNJA 3MWIU 3ZVBA 2B0FA 1AY6H 1LVYA 1FY1A 2BYAX 2UUFB 1C4U2 1K1LA 1P2JA 1PQ5A 1C1VH 1IOEA 1AVWA 2FS9A 4D7FA 2FOAA 3SOSA 3TH4H 4XFQA 2FI4E 4O03A 1PPEE 4A1TA 4TWWA 1ZJDA 4Q7XA 5GXPA 1LQDB 4BAMB 1NESE 3UOPA 3A8BA 3EA9A 4IMZA 2C3SA 4YTAA 4BXWA 1QNJA 1AWHB 1MUEB 1VITH 1T8NA 1O2LA 1JWTA 5SGAE 1RGQA 2BTCE 2BVSH 2J2UA 5DO4H 5AVDA 1EZXC 4ZH8A 1WQVH 2OC7A 2R3YA 3RXCA 1SOTA 3RXSA 2OTVA 1GHWH 2OBQA 5JB9S 1ZPBA 2ANWA 1EZUC 1VITG 3LGWA 7ESTE 1E37B 1ANDA 1NROH 1AVXA 2VWLA 4Q7YA 2IPHA 2UWLA 2BD5A 4H42U 3N7OA 1ZTKA 4NA7A 4NCYA 3I29A 1KXCA 1QBOA 4ISIH 3E91A 4X2XA 4ASHA 2R2MB 1A7SA 2Y7XA 3S7HB 2Z3DA 1LPKB 4UDWH 4FUCA 5HM2A 1MAYA 1RIWC 1UCYK 1A1RA 1CSOE 1SBWA 4Q7ZA 1TPPA 1UCYE 1F2SE 1ETTH 3RXHA 1ETRH 3T26A 1P09A 4JMYA 2ANKH 1EPTB 4ZKNU 1ZTJA 1QCPA 1GI0A 1C1UH 3QZQA 3S0NA 4JZDH 5DP9A 2WPKS 4LZ4B 4FUHA 1LO6A 2W7UA 1WSSH 1DX5M 3M35A 1XUFA 1K9OE 2PGBB 2ZGJA 1B5GH 3A7ZA 4Q2KA 1SGCA 1QRWA 2ZGHA 4U30A 2HPPH 3KQEA 1HAHH 1V2QT 1LKBA 1O2OA 2V3HH 4ZKRU 2TPIZ 2P8OB 3OX7U 1P04A 3NZIA 2C4FH 4NSYA 3SORA 1C2DA 1QJ7B 5EQRA 1UTLM 3B8JA 1O5EH 2CXVA 2B8OH 1O5AB 1C2GA 2B9LA 2VH6A 1NFUA 2PUXB 2ZFSA 2QF3A 4AFUA 1AVGH 5GWZA 1O3FA 3RXEA 1IHSH 1E36B 1P9SA 1J14A 4IMQA 1XUKA 5DP5A 1NRQH 2FPZA 2FOHA 2O8MA 1V2JT 4BAKB 1F5LA 1GBFA 4DG4A 2F91A 1ZR0A 2ANMH 2SGEE 1MZDA 5ABWA 1VGCB 1AFEH 5J4SA 5LPEA 1P02A 1W11U 2G81E 2QY0B 5IYTA 2NU3E 5HXFA 5FAHA 1GCDA 1O3HA 1P2MA 1C9TA 3ZZ8A 1FMGA 1G36A 1O2YA 2ODQA 1F5KU 1NT1A 3VB3A 1HAYB 2VB0A 2ESTE 1OWKA 1F0UA 1S5SA 2HRVA 4NIWA 1BZXE 1TNKA 1LVOA 2BX3A 3BTFE 3V13A 4AOQA 4K60A 1ZRKA 1V2RT 3BTTE 5E0GA 1NY22 1O0DH 5FBEA 5EXLA 3EE0B 3RU4T 4OS2A 1O2UA 3TH2H 4XDEA 1FIWA 1YC0A 4HTCH 1EPTA 1C2LA 2LPRA 2BXUH 2J34A 1TMTH 1ANCA 5FBIA 3FP7E 2F9OA 1QBNA 3NWUA 3RU4E 1K1OA 2J4IA 1O2JA 2PTCE 2R3UA 1GMDG 2TGDA 3E0NB 3LKWA 4HFPB 1BDAA 1G9IE 5E0JA 1SI5H 1W7XH 2ZG0H 3AW1A 4X6MA 4JYTA 2UWOA 5L6NH 4JZEH 2VU8E 4X8TH 1VCWA 3HK6B 1HJAC 1SFQB 1TMBH 1K22H 1GVZA 1HNEE 1K21H 2D8WA 2FYQA 2BVRH 3P92A 4CRCA 2FDAA 4NGAH 4MG3A 3RU4D 2G52A 2XWAA 4A1VA 1QA0A 2OCVB 5C1UA 2XC0A 1RTLA 1UK3A 3RXUA 1DUEA 4FVBA 3RXKA 1HFDA 1RS0A 1QRXA 2P95A 8LPRA 4NZQA 1T8LA 4AFSA 2J9NA 3D62A 1QQ4A 3KQCA 1SQOA 3RLYH 2FTLE 1D6WA 3TGKE 5A0CA 1GJBB 3ATMA 6ESTA 3U8OH 3SV6A 4O9VA 1MZAA 1KY9A 5LH8A 1AB9C 1OWIA 1Z8IB 1TGSZ 2BM2A 2XNIA 1BMLA 1Z8JB 4XSKU 4UEHH 4GAWA 4FU8A 3RXBA 1H9LB 2BLVA 5ESBA 4KP0A 1ELFA 3GDVA 3A83A 4B71A 1OP8A 1P9UA 2R2WU 2KAIB 1GDNA 1W0YH 1J8AA 3A80A 2GVFA 2BXTH 2PLXA 1ANEA 1O2HA 4Y8YA 2QXHA 2HLCA 4MLFB 4CBOA 1IQKA 3KGPA 2XCFA 1N1LA 3NUMA 4NA8A 2FMJA 4NWKA 3F9EA 1C2KA 3RM2H 2Q1JA 2FOMB 4RN6A 3GCHC 1ABIH 1HAVB 3VEQB 3F9HA 2AMQA 1C5SA 2W5EA 1GHBG 1WU1A 1C1WH 2F9BH 1F92A 2UUYA 4BOHA 4UONA 2BB4A 4ISOA 1SOZA 1FY4A 1HRTH 1P03A 1UVSH 3KEEA 3SGBE 3ZZCA 4GCHG 1AUTC 4BAQB 2CJIA 4GHTA 4Y76A 5F8ZA 1T32A 1OSSA 2ZEBA 3TGJE 7GCHF 1T4UH 2O9QA 3RXOA 2VIDA 1LVBA 1BTXA 4I8HA 3DT0H 1W10U 3VB5A 1GJ9B 1K1NA 2BOKA 3BF6H 4ISNA 1DOJA 5J4QA 3EDXB 4O97A 3T2NA 3FZZA 2P3FH 1CT2E 3PMHB 4ESTE 1SLUB 1UK4A 1O3DA 2ULLA 4E05H 2C93B 1Q31A 2TGAA 2PKAB 1YPHE 1SGFG 4X2YA 1P12E 4K8YA 3PO1B 5TCCA 4I33A 1TPSA 1DSTA 1GI3A 3TJNA 1SGEE 4TWYA 5JBAS 4KGAA 1DS2E 1O2SA 4LZ1H 2OXSA 3UY9A 2ZC9H 1MU8B 1A0LA 2GMTC 2BY9X 2JKHA 1Y5UT 2AMDA 2H9HA 2WINI 2OC0A 1GMDF 1VCQA 2Z3CA 4WWYA 3GYMA 4K3JA 4IN2A 1FN6A 1P2QA 4INHA 3ZVCA 1OWHA 4BNRA 1O3JA 3R0FA 2HPQH 5T3HA 2Y82A 2VIPA 3CP7A 3LONA 2TBSA 2XRCA 4YT7H 2BY7X 3SV9A 2SNWA 1GBBA 4IS5A 2TRMA 4NZLA 1G3BA 1EAWA 3U69H 3Q76A 1DWCH 3LJJA 1GBHA 2OLGA 5TJXA 2GX4A 1L4DA 1V2KT 2WV5A 1O35A 1UVUH 5H4IB 1SLXB 2VINA 3K9XB 3ZZ4A 6CHAB 2BD4A 3ZVAA 1BTWA 1SB1H 2G55A 1Z71A 2ZDLA 3PV4A 4DT7B 1YKTA 2P59A 4H4FA 2BDYA 5LGOA 4CRDA 1CT0E 2Z9KA 4NSVA 1BBRK 1LDTT 2F9VA 4YOJA 2ZU4A 3UUZA 2ZP0H 1BBRE 1T31A 2DE9A 3QX5H 3A7XA 4VGCB 1O3KA 1W0ZU 1EATA 1O2GH 2P94A 3PLPA 4LXBH 1H1BA 2Q6DA 3SNDA 1BTUA 1D3TB 2BDHA 3GDUA 1AMHA 4K69A 1GJ5H 1UMAH 3KCGH 2SGFE 2VVUA 3P17H 1UTNA 1EASA 2Y5HA 4AGJA 1LVMA 2ZDKA 1H9IE 2XBVA 1DXWA 1BMAA 4GVUA 2AIPA 2RG3A 3E8LA 1GBTA 1YPEH 5L2YH 3PM3A 1PPGE 3F1SB 2QC2A 1ELEE 4KELA 3W95A 2B7DH 5JB8S 1SG8B 4AG1A 1AUJA 1TE0A 2W26A 2PKSC 5F03A 2FO9A 3RXVA 4ZAEA 2SGQE 4E7NA 1HUTH 3OTJE 1P01A 3C27B 1A5GH 4Y8ZA 5A0AE 1Y3XA 3LJOA 2A4RA 3SI4H 2A7CA 3M3TA 2PR3A 3HGNA 5I25A 3SV8A 2UUJB 2H2ZA 1QY6A 3SU5A 1ABJH 5A0BA 1CQQA 1G2LA 2Z94A 1D9IA 1SL3A 3PTBA 1N8OC 4ZXYH 3TK6A 2A5KA 2BY6X 1MMJN 1Z8GA 4DY7B 1D6RA 3TJUA 1C1PA 5EU8A 1YCPH 3D49H 1GJ6A 3PMJA 1CA0C 5TCAA 1EX3A 1G3DA 1TNGA 2EC9H 2GCHF 4ABAA 2EI8A 1BHXB 1D3QB 1JRSA 3U9AH 5G4BA 3RXLA 1FY3A 2W3KA 2GZ9A 1ZLRA 1C5TA 3RUOA 1CE5A 1TRYA 5CHAC 1O30A 1HB0B 4X2VA 3RXGA 3U8TH 5A09A 2FESH 1QURH 1H4WA 2YNBA 1JRTA 3WY8A 2Y5GA 1NRNH 1TALA 2CMYA 1TQ7B 1ZHPA 2FOCA 3BIUH 2BLQA 1A5IA 1YBWA 3GY6A 2VWNA 1PQAA 4FUIA 3TITA 5CMXH 1SQTA 2WPLS 4YLUA 2JETB 1V6DA 3VFEA 1A4WH 1O5CB 3SI3H 4YLQH 3ZZDA 1HAOH 3MO9A 1LQEA 3CS7A 3GISB 1PPCE 1KTSB 1Z6JH 2EEKA 1DWBH 3VXFH 2ZCLP 1K1PA 4FUJA 4WH6A 4CR9A 3S9CA 1ZMNA 1C5VA 1CVWH 4I8LA 3QGJA 3ATWA 1P10A 4JYVH 4WF8A 1O3NA 1GPZA 3H7OA 4FUDA 1O38A 1WAYB 3ODDA 2FZZA 7LPRA 4MPWA 3UTUH 1EJNA 1ARCA 2OP9A 4TYDA 2ZF0H 2TGTA 4F49A 1P3CA 5HYOA 2OD3B 1GHXH 2A7JA 1UTPA 3G01A 5DP7A 4LK4A 3ATLA 3U98H 2QCYA 1O2QA 4E7RG 1AQ7A 2C8ZB 4X6PA 1GHAF 1FY5A 3PTNA 1EXFA 3MMGA 3MU1A 1O3AA 1WUNH 1C5RA 1SPJA 3SUEA 4TPIZ 1KLTA 2GT8A 3LGIA 1P3EA 1VZQH 2BDBA 1GBJA 2ZDMA 1G32B 2J95A 1O2MA 4CREA 3NKKA 3LPRA 1ACBE 3SU6A 1YCPK 1K1MA 5FXLA 4YM9A 1EB1H 1O34A 1E38B 2G4UA 3PYHA 2EI6A 3A87A 1G37A 1EAUA 1BMMH 3QDZB 3T29A 1ESBA 1BJVA 1KIGH 2J94A 3A7WA 1H9HE 3ZYDA 1ANBA 1TGCA 5ETXA 1O36A 3E3TA 1BCUH 3QLPH 4NIYA 3B9FH 1HCGA 2PTNA 5F8XA 1TB6H 4K1SA 1ELDE 4OS5A 4MNVA 1HAXB 1C1OA 1EKBB 1RTFB 4OS6A 4Y7AA 1YPHC 3TJVA 2V3OH 2VWOA 2WYJA 2BY8X 1UTMA 2ZI2H 2AS9A 2JH6D 4B76A 1TAWA 1WTHD 4X1PU 3NXPA 4GLYA 1KXEA 2F83A 4WMDA 1GL0E 3ZYEA 4A92A 3SJ8A 3E1XB 3ZZ6A 5EPYA 3URCA 2ZHQH 3E0PB 3BTEE 4MDSA 1DE7H 1TX8A 3P8GA 1AD8H 3KQBA 2VIOA 1QBVH 1TRMA 4B75A 4B73A 1IHTH 3MHWU 6GCHF 1EJAA 2A5IA 3UPEA 3LIWA 1TGBA 4U01A 4FUFA 3Q3KA 4IBLH 4AORA 1ZJKA 5LPFA 1A3EH 3RLWH 2QYIA 1TOCB 2VVVA 1DY9A 1QL8A 5HGGA 1OOKB 3BEIB 1KXBA 2W7SA 2P93A 3AVZA 5DP6A 5EG4A 1LHGH 1BQYA 3RXFA 3FAOA 8ESTE 2ZGBH 4SGBE 1QGFA 1O3PB 3DUXH 2ALVA 7GCHG 4WY3A 2G5NA 1MBQA 1CBWB 2ZTZA 1FAXA 5EXMA 4GHQA 1CHGA 3QWCH 2UUKB 1A61H 4UFDH 3IITA 1JMOH 3TNSA 3TLOA 1K28D 4DJZB 1AKSA 2AYWA 3SN8A 2XW9A 3A8CA 1Y3VA 3RXIA 1A2CH 1Y3WA 1MH0A 1W7GH 2A1DB 4XBCA 1KTTB 2PSXA 2HNTE 5JBTA 1W13U 1A0HB 3TU7H 1T4VH 2WV4A 4Z0KA 3ZVEA 3TVJB 2QIQA 3UFAA 1E0FD 2ZPQA 1MTWA 6CHAC 1J9CH 1DLEA 2ZIQH 1GVKB 3TPIZ 3A85A 4BANB 2GCTB 1TNHA 1GBDA 3A84A 3ELAH 1ORFA 5E2PA 3W94A 1NC6A 3BEUA 3MO6A 2FOBA 4JZ1A 1O3GA 2PWXA 3ESTA 3PROA 1WYKA 4AYYB 4DOQA 4KKDA 1Z8RA 1MTVA 3EGKH 2H6MA 4A7IB 3PMAB 4X1RU 1S85A 1AFQC 1O3MA 3V0XA 1SC8U 3LGYA 5C5NA 4OGXA 3SV2H 3IWMA 1BTHH 1FJSA 4UE7H 2QN5T 3EA8A 2ZPRA 2WUBA 1C5WB 2SGAA 1PQ7A 4DIHH 3S9BA 2ZQ1A 1RJXB 1ARBA 4O3TA 3M5OA 7KMEH 1BJUA 3MNCA 1THSH 1L2EA 3KQDA 3P8FA 4ZROA 4UD9H 4ISHH 2SGDE 1UTOA 4D7GA 2B5TB 3FP6E 5EW2H 3BEFB 3JZ2B 3BG4C 3UNSA 3RMMH 5AFYH 1NU7B 2BLWA 3LC5A 4YT6H 1PFXC 1F0TA 1AIXH 1ZHMA 3MI4A 2HWLB 1EJMA 2ZHEH 4INLA 1RD3B 3PLKA 3LU9B 1KXFA 1O37A 3M3VA 4IC6A 4TPYA 2BD7A 1DXPA 5EW1H 1Y8TA 3BTWE 2XTTB 3UIRA 2ZDAH 4ZHMU 3RXJA 4B2AA 1K1JA 2J38A 5FX5A 5A2MH 2ZU1A 3A81A 1FLEE 4Y0YE 3FANA 2EA3A 1MKWH 3VGCC 2H5CA 2Y7ZA 3RMLH 1OWJA 2HNTF 2F9NA 5T6FA 1FI8A 2F3CE 4THNH 1EAXA 1P0SH 2A2XH 1F0SA 3BTKE 2Z9IA 2NWNA 1HJ8A 1SR5C 2C8XB 2ZGXH 1ZMJA 2M5TA 1HXEH 1LHCH 1SGDE 1BITA 1YF4A 1TWXB 1GJCB 1AWFH 4X1NU 1BA8B 4UFGH 1JOUB 4DIIH 2OQ5A 2A31A 2H9EH 1IQFA 1L1JA 4AN7A 1F7ZA 1C5OH 2BDAA 4AFZA 1QB9A 5EODA 1FPCH 1FUJA 5FCRA 3A82A 1DPOA 3ZZ5A 2AGIX 3P6ZB 2OUAA 4WMFA 4X1SU 2Z6BD 4IC5A 3DD2H 1NTPA 3NK8A 4ZKOU 2BD2A 3ZZ7A 4XBBA 1AE8H 1TFXA 1C5UA 3TGIE 1T8OA 1GBMA 2JETC 4AYVB 1UVTH 4X8VH 4K1EA 2P3UB 2BOHB 1H8IH 5K0HA 4A5TS 1ZPCA 4GSOA 2BDCA 3P8NA 1SGRE 1BBRH 2FEQH 2ZQ2A 1O3OA 2I6QA 3HKIB 4WH8A 2ZECA 4ABJA 1FQ3A 2GCHG 1TPOA 3FP8E 2JH0D 1P05A 5GJ4B 3GY3A 2R0KA 2QXIA 3QK1A 3A88A 1GBCA 4NIXA 3RXAA 4E06H 4AZ2B 1GBAA 2ZFFH 1LMWB 4B74A 3GDSA 2PGQB 3F68H 3M5NA 3RXMA 3GY7A 2QV1A 3MH7A 2AERH 2AGEX 3UQOA 3BSQA 3FVFB 4Q80A 5EGMA 2ZKSA 1DLKB 1BRUP 4IGDA 1OWEA 2WPHS 3RMOH 3SUDA 3VXEH 3U1JB 1EP5A 3EA7A 2ZU2A 2TIOA 2FI5E 1O5BB 1YP9A 3QTVH 5C5OA 1MD7A 5K7RA 4NFFA 4Y8XA 3QGNB 1P06A 1J15A 1MKWK 1SQAA 1N6YA 1HPGA 1TX6A 1YPLH 1MKXH 3OY6U 1GMHF 3KF2A 1OX1A 2BDIA 1ELTA 1B0FA 1EAIA 1HXFH 1O3EA 1DITH 1C2IA 1DDJA 5L2ZH 3M61U 2BX4A 2GT7A 4BTUB 1GDQA 1C9PA 4YO9A 4DCDA 1D3PB 1GJDB 1TBZH 2DE8A 2ASUB 3ZZAA 4CBNA 4MNWA 1MTUA 1CT4E 1V2MT 4HGCA 2RA3A 3GCTF 5LPRA 1BMNH 1V3XA 3MH5A 5DKMA 1UVOA 4INKA 1THRH 3O8BA 1RTKA 1SVPA 1TMUH 1EUFA 2FM2A 2Y5FA 2BLOA 1EOLA 3E6PH 2SFAA 1GBKA 3OSYA 3L3TA 3UREA 1AHTH 4Y10E 1BT7A 1IQLA 5FCKA 3LDXH 1TONA 4CH2B 5T6GA 2Q6FA 1JXPA 1ELAA 1Y5AT 2H9TH 3V12A 1HIAA 1GHAG 1QL9A 1O2TA 1FNIA 1EPTC 1SSXA 1AE5A 4HZHA 4NWLA 2P3TB 1GI1A 1TA2A 3JZ1B 1V2WT 3RM0H 2A2QH 3MH6A 1HAGE 2ODPA 3GYLB 1RRKA 3KNXA 1O5GH 1O2VA 4BAOB 1OYTH 1LHDH 1AO5A 2GZ7A 2C90B 2FTMA 4AX9H 1H8DH 1DUAA 2D2DA 2XBYA 2P8OC 5GDSH 1BTYA 2VIQA 1K1IA 2FS8A 3H5CB 3LGUA 1T7CA 3Q3YA 2VNTA 4AG2A 2FX4A 4D76A 1C5XB 4J1YA 2PFEA 1AZZA 1L1NA 4FVDA 2FODA 1SLWB 2AMPA 1ZHRA 3CENA 1D4PB 3OYPA 3ZV8A 3EAJA 5FX6A 1WCZA 2ZFTA 3BTGE 3KL6A 2VGCB 4B2CA 2ZPSA 2RA0A 1YYY1 3ATKA 4DVAU 4I8JA 4NFEA 2XC5A 2HNTC 1BRBE 1GI7B 2STBE 9LPRA 4Z6AH 2NU2E 3OU0A 5JBBS 3KHVA 5I46H 1MKXK 1VGCC 1ZZZA 5T6DA 5DP8A 1O2XA 3ZVGA 4F4OC 1O2PA 1CBWC 3LGVA 3M7QA 1NFWA 4X6NA 3ITIA 5EQQA 2XCNA 1NFYA 3BN9A 5PTPA 1SHYA 3IG6B 5E0HA 2BHGA 4QT8C 1YCPM 1VJ9U 2A0QB 3M7TA 2GZ8A 1PPFE 6GCHG 5DG6A 1RXPA 1F0RA 1UK2A 2W3IA 1SGYE 5AHGH 1CGHA 1MQ6A 3QUMP 3NCLA 2Y80A 3DA9B 3UNQA 1FIZA 2BZAA 1LHEH 3B23B 2XC4A 3HATH 1GI2A 3SJIA 1GG6B 2BZ6H 1SGQE 9ESTA 2ZA5A 1V2VT 1LTOA 1P11E 1GBIA 1AB9B 3TIUA 3SU4A 1GGDB 1GI6A 1SGFA 2PSYA 3DFLA 5B6OA 3ODFA 4X2WA 5FPTA 3EYDA 3GY4A 3A8DA 3R3GB 3SJ9A 2V35A 1O2IA 3SU1A 3ZZBA 2GDDA 3T62A 5DJ7A 3HKJB 1Y3UA 1W12U 3GICB 4R0IA 1KSNA 3M3SA 4MNYA 3QTOH 4JZFH 4CR5A 2VWMA 1A46H 1NO9H 5JYIA 4CRBA 1XXDA 1IQNA 1KDQA 1TRNA 2TGPZ 4TY6A 3U8RH 1GI4A 3S69A 3SU3A 2BVXH 4I32A 1WOFA 2QGRA 3GCHB 3MTYA 1O3BA 1E34B 1OYQA 3AASA 3URDA 4CRAA 2IN2A 3AAVA 1FV9A 1BTPA 1KXAA 3LC3A 5EXNA 2R9PA 1GCTB 3A7YA 1QJ1B 1O5FH 4YESB 5FPSA 4BAHB 1IQMA 3SHAH 1HGTH 3FFGA 1J16A 3LH3A 2J92A 1YM0A 1MD8A 1GVLA 1ZSKA 1NFXA 1O33A 2XWBI 3CS0A 3SJOA 1SLVB 4ISLA 2AFQB 2NU4E 1TNLA 2Z9LA 1AU8A 5IDKA 1LCYA 1W8BH 4DURA 3STJA 3SV7A 4O3UA 2XBXA 1XVMA 1TGNA 2DUCA 1UTJA 3MNXA 1QR3E 1O2RA 1C5YB 1LHFH 2FLBH 3Q3XA 4WMEA 1ETSH 2ZWLH 2V6NA 1QHRB 1UJ1A 2OQUA 3V7TA 4A6LA 1P8VC 4K1TA 3SHCH 1O32A 1ZPZA 1IQGA 1TIOA 5C3NA 1QIXB 1GJ7B 1GL1A 1MQ5A 1IQJA 1YLDA 5F8TA 1DT2A 4NG9H 3SNAA 3SQEE 1NN6A 2H5DA 1UVPA 1S81A 4ZHAA 2GMTB 6LPRA 4WVPE 1XUHA 1ELVA 1AKSB 1UHBB 2NU0E 4ABIA 4SGAE 4NIVA 1ZSLA 2YNAA 5C20A 1C1QA 1EZSC 2ZU5A 3SO3A 3MH4A 1Z7KA 2WPMS 1BIOA 2ILNA 1BHXF 3DFJA 3NPSA
chains in the Genus database with same CATH superfamily
1HDTH 5C67A 1FONA 1H8ED 3ZVFA 1GHZA 4HI3A 3UNRA 2A4GA 1S84A 2LP6A 1TQ0B 3M5LA 1OWDA 2ZFQH 1GDUA 3PLBA 3KN2A 2CHAB 2GDEH 1ELGA 1YPKH 4OS4A 1V2PT 1CGJE 1CHOF 2PUQH 5BRRE 4MTBA 2ZFPH 3RXDA 4Y11E 1XX9A 3UWIA 2EY4C 4Y6DA 4ABBA 3SGQE 3PMBB 1EB2A 1DWDH 1KYNA 1C1NA 4ZXXH 2ZHFH 5GCHG 1DFPA 4CH8B 1LPZB 1SGIB 3A7TA 3AK5A 5HMAA 1QB1A 1XVOA 5JBCS 1MAXA 5EQSA 2PV9B 3BG8A 4AGKA 2O8UA 2ZDVH 1P2KA 3RC6A 1GMCG 1GHYH 2HLDD 3RXTA 3PO1C 4TY7A 1GI8B 5GIBA 1GI5A 2QXJA 3T28A 1ZOMA 1QA7A 1X7AC 3GY5A 1IQEA 1UO6A 2BQ7B 2V0BA 4XOJA 3P8OA 1QFKH 1P2OA 2D1JA 1G3EA 1ZYOA 1OKXA 4MPVA 1IAUA 4XRNA 1A0JA 3K6YA 2V3MA 2ZU3A 4JK5A 2F9UA 1O2KA 1F5RA 2BQWB 4X0WU 2QAAA 1G30B 3DHKH 1NRSH 1CU1A 3L6PA 2FWWA 3H7TA 5C1XA 2VIVA 1Z6EA 3QO6A 2IJOB 3T25A 1UHBA 2BY5X 5L30H 1DVAH 1W2KH 1ZMLA 2K1QA 4WXIA 3TK5A 1C2JA 4H6SB 4WXVA 3VB4A 2PKSB 1ZGVA 3A86A 2FI3E 5DPAA 3SU0A 4FXGH 3Q77A 2M2AA 3TJOA 3LH1A 2ZDNA 4ACBA 1JBUH 2RDEA 1P2NA 1PQ8A 1AI8H 2IPQX 3BTDE 3GCOA 2J97A 3K2UA 1C2FA 5E2OA 3T5FH 1WBGB 2A7HA 2D26C 5ESTE 1O2NA 1HV7A 1N8OB 3UR6A 1GMHG 3ZZ3A 1YLCA 4IW4E 2GP9B 1MTNB 4R8TB 1S82A 1SMFE 3UB0A 1M9UA 1CA0B 3I77A 1Q2WA 1TYNA 3PWCA 2PHBA 2Z9GA 4RKJB 3C1KA 1BRCE 3MNBA 4I8KA 4VGCC 4MQAA 1FAKH 5JPMH 2PW8H 4IN1A 1OXGA 5DP4A 1UTQA 3GCTG 3SNCA 1NZQH 3F9GA 2A4QA 1DM4B 3MU4A 4AB9A 5CHAB 1V2NT 1U6QA 1ELCA 4Y7BA 1AGJA 1T8MA 1HBTH 3PRDA 1NPMA 2A32A 8KME2 1XMNB 3LOXA 2HALA 3AW0A 1C2EA 5HIZA 4RI0A 2VGCC 4DW2U 4ZMAH 1C2HA 1TPAE 4LOYH 4FU7A 2OBOA 2OINA 4I31A 3SJKA 5A8YA 3P70B 1VCPA 5DP3A 8GCHG 1AN1E 4ZKSU 1TNIA 1D3DB 3GY8A 3SUGA 4ABGA 2GKVE 1OS8A 1OPHB 4GPGA 1TLDA 4CHAB 1DWEH 2GTBA 2P16A 4ZCNA 4B6EA 1YPJH 2J98B 2FP7B 1VITF 3E16B 3EE7A 4ABHA 3PB1E 3VB7A 2CN0H 4K2YA 1WV7H 1XUJA 2OC8A 1O31A 3LGTA 3MU5A 4DGJA 2ZTXA 2ZZUH 1MTSA 2LNCA 5FPYA 2H1UA 4JYUH 4AFQA 2ODYB 2G51A 3MNSA 1XKBC 2VBCA 3GCNA 2VVCA 3RXQA 3RXRA 1MBMA 1BB0B 1GG6C 2KZ4A 2BMGB 1JIMA 1KLIH 1FXYA 1O3CA 2I6SA 3UWJH 4CRFA 1NS3A 3BV9B 3M7UA 2VH0A 3SU2A 2RFKC 1GGDC 4NA9H 2A45B 5GCHF 1XUIA 2G00A 3AAUA 2SGPE 1V2UT 2Q6GA 1HYLA 1V2ST 1WTGH 1DSUA 4MPXA 2XBWA 2XXLA 1DANH 3HPTB 3VPKA 1XKAC 2IOTA 5C1YA 3UQVA 1GMCF 1PYTD 3SQHE 2BD9A 3FZDA 3BTHE 1EQ9A 3FOAA 4J2YB 3TK9A 1Z1JA 1L0ZA 4X6OA 2G4TA 3VB6A 2QA9E 1C5LH 1Z1IA 2A5AA 3OY5U 4ZUHA 3SNBA 1TABE 3RDZA 1LKAA 1DY8A 1HIAB 2FLRH 1EZQA 2JH5D 1IQIA 5HM9A 2C8YB 4OS7A 1V2LT 2QXGA 3SYJA 3V3MA 3RXPA 3RC5A 1S0RA 2HVXA 1O5DH 1Y5BT 2ANYA 2R0LA 1RIWB 1NBMD 3BIVH 1C5MD 5C2ZA 1SFIA 3KIDU 2ZHDA 1Y3YA 1NRRH 1GCTC 4D9QA 1XXFA 3SUFA 2G8TA 1ESTA 3MO3A 1QTFA 1HAIH 1V2TT 2CF9H 3RP2A 3ZVDA 1NM6A 1TA6A 1C5ZB 5C94A 5A8XA 1TBQH 3TH3H 1NRPH 3MU8A 1CO7E 3L33A 3P95A 2WYGA 3BTQE 4M7GA 2EI7A 2IJD1 2AEIH 3M36A 1ELBA 5JDUB 4Y0ZE 1MCVA 4UFEH 2FX6A 2ZHWH 1GHVH 1OP0A 5EPNA 1BOQA 3UR9A 4ABDA 1JIRA 2UWPA 4BXSA 3SW2B 4RSPA 4X8SH 1L4ZA 1FN8A 1IQHA 4MVNA 1PPHE 4OS1A 1O3LA 4FU9A 1KXDA 4FUEA 1ZTLA 3QN7A 4I8GA 2ZCKP 2AIQA 4ZHLU 4X8UH 2KR7A 1TOMH 2KAIA 3O8DA 5DSFA 4JZIA 1FPHH 1GJ8B 1C5NH 1B7XB 1A5HA 3NRLA 3GY2A 1PJPA 1Y59T 3E90B 5IK2D 4H6TA 5DK1A 1G2MA 1O3IA 1TBRH 2FOGA 1YGCH 4K8BA 1S6FA 3MFJA 1QQUA 3Q00A 1HAVA 1PPZA 1LPGB 1W14U 1NU9A 2CGAA 3M37A 4KTCA 2CHAC 5DGJA 3M5MA 5GNDA 1GJ4H 3SBKA 1WQSA 1ZRBA 4BTTB 1CGIE 2O8LA 2AGGX 1QRZA 4BTIB 5F6MA 1XUGA 1GWAA 2FOEA 4XBDA 1K0HA 1C1TA 4KTSA 1Q3XA 1ZGIA 2AH4X 2ZO3H 2OK5A 4D8NA 1EOJA 3O8RA 4YZUA 4RKOB 1ZSJA 4Y71A 4UFFH 1MABB 2BDGA 3OAAD 3SNEA 2SNVA 4Y79A 1QL7A 4CRGA 4AB8A 3A7VA 1KDQB 1N6XA 1YWUA 3I78A 1BUIA 4OGYA 1HAPH 2Z3EA 3D65E 5A8ZA 1HLTH 2STAE 4KTUA 1SHHB 2HGTH 4WJG2 3A89A 2GV7A 2L6OA 1W3CA 2RCEA 1AFQB 3FN8A 2THFB 2Y81A 1TGTA 4MNXA 3SZNA 4JCNA 4D9RA 1J17T 5GPIB 4U32A 2PKAA 1EFRD 4Q63A 5BPEA 1L1GA 1DICA 1ESAA 3T27A 1HJAB 3EQ0H 1TX7A 1QB6A 1MU6B 3F9FA 1GBLA 4X1QU 1C5PA 3F6UH 3BTME 1RFNA 1CHOG 4PROA 3MU0A 3K6ZA 3MYWA 3BG4B 1V2OT 2CF8H 3RMNH 2VIWA 2OC1A 4JK6A 1O39A 4I7YH 4B2BA 1BTZA 4XE4A 1XM1A 2HOBA 2O8TA 1CA8B 1INCA 3MOCA 2FYRA 1O2WA 2WPIS 3S9AA 4FUGA 3QZRA 1C1MA 1SGNE 2NU1E 1KLJH 3PWBA 5KECA 2BD8A 2VJ1A 4MPUA 2HVYB 2ZNKH 1FY8E 1FZZA 4ABEA 1AZ8A 2Y6TA 1GHBF 2C8WB 4YOGA 1BRAA 1FX0B 1SGPE 2BD3A 3ENSB 4DT4A 1HAZB 3ATIA 3U1IB 2A4OA 1QJ6B 1VR1H 2ZTYA 3ZV9A 1B0EA 1YPGH 3VGCB 2Z7FE 2WUCA 1UTKA 1G3CA 3D23A 2GCTC 1S0QA 2KCPA 2WHXA 3A8AA 4U2WA 2G5VA 4GCHF 2FOFA 2BQ6B 1MTNC 2ZCHP 2ZGCA 1S83A 2Z9JA 3O8CA 1P57B 1FDPA 5CE1A 3STIA 1EP6A 3F2HA 1P2IA 3HK3B 5AFZH 4A1XA 2WPJS 1C1RA 2GGVB 1K2I1 3TNTA 4K5ZA 1C2MA 2ALPA 1GJAB 1THPB 4GUXA 3RC4A 5E8EH 1YPMH 4FUBA 3K65B 1C4Y2 1A3BH 5FHTA 1MCTA 3LT3A 1GBEA 1VJAU 1UCYH 3ZZ9A 1PYTC 2RDLA 3SGAE 2CV3A 1GI9B 1SGTA 2ZFRH 4B1TA 2O8WA 3UOUA 1C5QA 5AF9H 2FXRA 1S6HA 1OP2A 4ABFA 2XYAA 2QF0A 1E35B 3HGPA 1C1SA 2F9PA 2YOLA 2FIRH 1C4V2 5EOKA 2GV6A 4CHAC 3GOVB 1O2ZA 1ID5H 4YOIA 3S7KB 1HJ9A 2GD4B 1PPBH 1TNJA 3MWIU 3ZVBA 2B0FA 1AY6H 1LVYA 1FY1A 2BYAX 2UUFB 1C4U2 2KM0A 1K1LA 1P2JA 2K0QA 1PQ5A 1C1VH 1IOEA 1AVWA 2FS9A 4D7FA 2FOAA 3SOSA 3TH4H 3F0PA 4XFQA 2FI4E 4O03A 1PPEE 4A1TA 4TWWA 1ZJDA 4Q7XA 5GXPA 1LQDB 4BAMB 1NESE 3UOPA 3A8BA 3EA9A 4IMZA 2C3SA 4YTAA 4BXWA 1QNJA 1AWHB 1MUEB 1VITH 1T8NA 1O2LA 1JWTA 5SGAE 1RGQA 2BTCE 2BVSH 2J2UA 5DO4H 5AVDA 1EZXC 4ZH8A 1WQVH 2OC7A 2R3YA 3RXCA 1SOTA 3RXSA 2OTVA 1GHWH 2OBQA 5JB9S 1ZPBA 2ANWA 1EZUC 1VITG 3LGWA 5HIYA 7ESTE 1E37B 5C0UA 1ANDA 1NROH 1AVXA 2VWLA 4Q7YA 2IPHA 2UWLA 3N7EA 2BD5A 4H42U 3N7OA 1ZTKA 4NA7A 4NCYA 3I29A 1KXCA 1QBOA 4ISIH 3E91A 4X2XA 4ASHA 2R2MB 1A7SA 2Y7XA 3S7HB 2Z3DA 1LPKB 4UDWH 4FUCA 5HM2A 1MAYA 1RIWC 1UCYK 1A1RA 1CSOE 1SBWA 4Q7ZA 1TPPA 1UCYE 1F2SE 1ETTH 3RXHA 1ETRH 3T26A 1P09A 4JMYA 2ANKH 1EPTB 4ZKNU 1ZTJA 1QCPA 1GI0A 1C1UH 3QZQA 3S0NA 4JZDH 2WPDD 2WPKS 5DP9A 4LZ4B 4FUHA 1LO6A 2W7UA 1WSSH 1DX5M 3M35A 1XUFA 1K9OE 2PGBB 2ZGJA 1B5GH 3A7ZA 4Q2KA 1SGCA 3F2GA 1QRWA 2ZGHA 4U30A 2HPPH 3KQEA 1HAHH 1V2QT 1LKBA 1O2OA 2V3HH 4ZKRU 2TPIZ 2P8OB 3OX7U 1P04A 3NZIA 2C4FH 4NSYA 4F55A 3SORA 1C2DA 1QJ7B 5EQRA 1UTLM 3B8JA 5F53A 1O5EH 2CXVA 2B8OH 3PRBA 1O5AB 1C2GA 2B9LA 2VH6A 1NFUA 2PUXB 2ZFSA 2QF3A 4AFUA 1AVGH 5GWZA 1O3FA 3RXEA 1IHSH 1E36B 1P9SA 1J14A 4IMQA 1XUKA 5DP5A 1NRQH 2FPZA 2FOHA 2O8MA 1V2JT 4BAKB 1F5LA 1GBFA 4DG4A 2F91A 1ZR0A 2ANMH 2SGEE 1MZDA 5ABWA 1VGCB 1AFEH 5J4SA 5LPEA 1P02A 1W11U 2G81E 2QY0B 5IYTA 2NU3E 5HXFA 5HKKD 5FAHA 1GCDA 1O3HA 1P2MA 1C9TA 3ZZ8A 1FMGA 1G36A 1O2YA 2ODQA 1F5KU 1NT1A 3VB3A 1HAYB 2VB0A 2ESTE 1OWKA 1F0UA 1S5SA 2HRVA 4NIWA 1BZXE 1TNKA 1LVOA 2BX3A 3BTFE 3V13A 4AOQA 4K60A 1ZRKA 1V2RT 3BTTE 5E0GA 1NY22 1O0DH 5FBEA 5EXLA 3EE0B 3RU4T 4OS2A 1O2UA 3TH2H 4XDEA 1FIWA 1YC0A 4HTCH 3WWBA 1EPTA 1C2LA 2LPRA 2BXUH 2J34A 1TMTH 1ANCA 5FBIA 3FP7E 3WW7A 2F9OA 1QBNA 3NWUA 3RU4E 1K1OA 2J4IA 3DCLA 1VKYA 1O2JA 2PTCE 2R3UA 1GMDG 2TGDA 3E0NB 3LKWA 4HFPB 1BDAA 1G9IE 5E0JA 1SI5H 1W7XH 2XOKD 2ZG0H 3AW1A 4X6MA 4JYTA 2UWOA 5L6NH 4JZEH 2VU8E 4X8TH 1VCWA 3HK6B 1HJAC 1SFQB 1TMBH 1K22H 1GVZA 1HNEE 1K21H 2D8WA 2FYQA 2BVRH 3P92A 4CRCA 2FDAA 4NGAH 4MG3A 3RU4D 2G52A 2XWAA 4A1VA 1QA0A 2OCVB 5C1UA 1SKYE 2XC0A 3DSPA 1RTLA 1UK3A 3RXUA 1DUEA 4FVBA 3RXKA 2WSSD 1HFDA 1RS0A 1QRXA 2P95A 8LPRA 4NZQA 1T8LA 4AFSA 2J9NA 5FL7D 3D62A 1QQ4A 3KQCA 1SQOA 3RLYH 2FTLE 1D6WA 3TGKE 5A0CA 1GJBB 2YMSB 3ATMA 6ESTA 3U8OH 3SV6A 4O9VA 1MZAA 3KYFA 1QZ8A 1W0KD 1KY9A 5LH8A 1AB9C 1OWIA 4TT3D 1Z8IB 1TGSZ 2BM2A 2XNIA 1BMLA 1Z8JB 3PV2A 4XSKU 4UEHH 4GAWA 4RT0A 4FU8A 1NBME 3RXBA 1H9LB 2BLVA 5ESBA 4KP0A 1ELFA 3KYGA 3GDVA 3A83A 4B71A 1OP8A 1P9UA 2R2WU 2KAIB 1GDNA 1W0YH 1J8AA 3A80A 2GVFA 2BXTH 2PLXA 1ANEA 1O2HA 4Y8YA 2QXHA 2HLCA 4MLFB 4CBOA 1IQKA 3DSGA 3KGPA 2XCFA 1N1LA 3NUMA 4NA8A 2FMJA 4NWKA 3F9EA 1C2KA 3RM2H 4ACAA 2Q1JA 2FOMB 4RN6A 3GCHC 1ABIH 1HAVB 3VEQB 3F9HA 2AMQA 3U28C 1C5SA 2W5EA 2J5UA 1GHBG 1WU1A 1C1WH 2F9BH 3UAIC 1F92A 2UUYA 4BOHA 4UONA 2BB4A 3WWFA 4ISOA 1SOZA 1FY4A 1S6LA 1HRTH 1P03A 1UVSH 3KEEA 3SGBE 3ZZCA 4GCHG 1AUTC 4BAQB 2CJIA 4GHTA 4Y76A 5F8ZA 1T32A 1OSSA 2ZEBA 3TGJE 2YMSD 7GCHF 1T4UH 2O9QA 3RXOA 2VIDA 1LVBA 1BTXA 4XD7D 4I8HA 3DT0H 1W10U 3VB5A 1GJ9B 1K1NA 2BOKA 3BF6H 4ISNA 1DOJA 5J4QA 3EDXB 4O97A 3T2NA 3FZZA 2P3FH 1CT2E 3PMHB 4ESTE 1SLUB 1UK4A 1O3DA 2ULLA 4E05H 2C93B 1Q31A 2TGAA 2PKAB 1YPHE 1SGFG 4X2YA 1P12E 4K8YA 3PO1B 5TCCA 4I33A 1TPSA 1DSTA 1GI3A 3TJNA 1SGEE 4TWYA 5JBAS 4KGAA 1DS2E 1O2SA 4LZ1H 1BMFD 2OXSA 3UY9A 1YLNA 2ZC9H 1MU8B 1A0LA 2GMTC 2BY9X 2JKHA 1Y5UT 2AMDA 2H9HA 2WINI 3PV5A 2OC0A 1GMDF 1VCQA 2Z3CA 4WWYA 3GYMA 4K3JA 3N7DA 4IN2A 1FN6A 1P2QA 4INHA 3ZVCA 1OWHA 4BNRA 1O3JA 4Q4LA 3R0FA 2HPQH 5T3HA 2Y82A 2VIPA 3CP7A 3LONA 2TBSA 2XRCA 4YT7H 2BY7X 8GCHF 3SV9A 2SNWA 1GBBA 4IS5A 5B6LA 2TRMA 4NZLA 1G3BA 1EAWA 3U69H 3Q76A 1DWCH 3LJJA 1GBHA 2OLGA 5TJXA 2GX4A 1L4DA 1V2KT 2WV5A 1O35A 1UVUH 5H4IB 1SLXB 2VINA 3K9XB 3ZZ4A 6CHAB 2BD4A 3ZVAA 1BTWA 1SB1H 2G55A 1Z71A 2ZDLA 3PV4A 4DT7B 1YKTA 2P59A 4H4FA 2BDYA 5LGOA 4CRDA 1CT0E 2Z9KA 5EJ1A 4NSVA 1BBRK 1LDTT 2F9VA 4YOJA 2ZU4A 3UUZA 2ZP0H 1BBRE 1T31A 2DE9A 3QX5H 3A7XA 4VGCB 1O3KA 1W0ZU 1EATA 1O2GH 2P94A 3PLPA 4LXBH 1H1BA 2Q6DA 3SNDA 1BTUA 1D3TB 2BDHA 3GDUA 1AMHA 4K69A 1GJ5H 1UMAH 3KCGH 2SGFE 2VVUA 3P17H 1UTNA 1EASA 2Y5HA 4AGJA 1LVMA 2ZDKA 1H9IE 2XBVA 1DXWA 1BMAA 4GVUA 2AIPA 2RG3A 3E8LA 4HG6A 1GBTA 1YPEH 5L2YH 3PM3A 1PPGE 3F1SB 2QC2A 1ELEE 4KELA 3F3BA 3W95A 2B7DH 5JB8S 1SG8B 4AG1A 1AUJA 1TE0A 2W26A 2PKSC 5F03A 2FO9A 3RXVA 4F48B 4ZAEA 2SGQE 4E7NA 1HUTH 3OTJE 1P01A 1OHHD 3C27B 1A5GH 4Y8ZA 5A0AE 1Y3XA 3LJOA 2A4RA 3SI4H 2A7CA 3M3TA 2GJGA 2PR3A 3HGNA 3SV8A 2UUJB 2H2ZA 5I25A 1QY6A 3SU5A 1ABJH 5A0BA 1CQQA 1G2LA 2Z94A 1D9IA 1SL3A 4P02A 3PTBA 1N8OC 4ZXYH 3TK6A 1WDIA 2A5KA 2BY6X 1MMJN 4B6FA 1Z8GA 4DY7B 1D6RA 3TJUA 1C1PA 5EU8A 1YCPH 3D49H 1GJ6A 3PMJA 1CA0C 5TCAA 1EX3A 1G3DA 1TNGA 2EC9H 2GCHF 4ABAA 2EI8A 1BHXB 1D3QB 1JRSA 3U9AH 5G4BA 3RXLA 1FY3A 2W3KA 2GZ9A 1ZLRA 1C5TA 3RUOA 1CE5A 1TRYA 5CHAC 1O30A 1HB0B 4X2VA 3RXGA 3U8TH 5A09A 2FESH 3MQKC 1QURH 1H4WA 2YNBA 1JRTA 3WY8A 3DSOA 2Y5GA 1NRNH 1TALA 2CMYA 1TQ7B 1ZHPA 2FOCA 3BIUH 2BLQA 1A5IA 1YBWA 3GY6A 2VWNA 1PQAA 4FETA 4FUIA 3TITA 5CMXH 1SQTA 2WPLS 4YLUA 2JETB 1V6DA 3VFEA 1A4WH 1O5CB 3SI3H 4YLQH 3ZZDA 1HAOH 3MO9A 1LQEA 3CS7A 3GISB 1PPCE 1KTSB 1Z6JH 2EEKA 1UW7A 1DWBH 3VXFH 2ZCLP 1K1PA 4FUJA 4WH6A 4CR9A 1WXRA 3S9CA 1ZMNA 1C5VA 1CVWH 4I8LA 3QGJA 3ATWA 1P10A 4JYVH 4WF8A 4P00A 1O3NA 1GPZA 3H7OA 4FUDA 1O38A 1WAYB 3ODDA 5C17A 2FZZA 4RT1A 7LPRA 4MPWA 3UTUH 1EJNA 1ARCA 2OP9A 4TYDA 2ZF0H 2TGTA 4F49A 1P3CA 5HYOA 2OD3B 1GHXH 2YMSC 2A7JA 1UTPA 3G01A 5DP7A 4LK4A 3ATLA 3U98H 2QCYA 1O2QA 4E7RG 1AQ7A 2C8ZB 4X6PA 1GHAF 1FY5A 3CNRA 3PTNA 1EXFA 3MMGA 3MU1A 1O3AA 1WUNH 1C5RA 2CK3D 1SPJA 3SUEA 4TPIZ 1KLTA 2GT8A 3LGIA 1P3EA 1VZQH 2BDBA 1GBJA 2ZDMA 1G32B 2J95A 1O2MA 4CREA 3NKKA 3LPRA 1ACBE 3SU6A 1YCPK 1K1MA 5FXLA 4YM9A 1EB1H 1O34A 1E38B 2G4UA 3PYHA 2EI6A 3A87A 1G37A 1EAUA 1BMMH 3QDZB 3T29A 1ESBA 1BJVA 1KIGH 2J94A 3A7WA 1H9HE 3ZYDA 1ANBA 1TGCA 5ETXA 1O36A 3E3TA 1BCUH 3FO8D 5EJLA 3QLPH 4NIYA 3H09A 3B9FH 1HCGA 2PTNA 5F8XA 1TB6H 4K1SA 1ELDE 4OS5A 4MNVA 1HAXB 1C1OA 1EKBB 3F2FA 1RTFB 4OS6A 4Y7AA 1YPHC 3TJVA 2V3OH 4TSFD 2VWOA 2WYJA 2BY8X 1UTMA 2ZI2H 2AS9A 2JH6D 4B76A 1TAWA 1WTHD 4X1PU 5C0TA 3NXPA 3ZIAD 4GLYA 1KXEA 2F83A 4WMDA 2JDID 2KX4A 1GL0E 3ZYEA 4A92A 3KQ5A 3SJ8A 3E1XB 3ZZ6A 5EPYA 3URCA 2ZHQH 3E0PB 3BTEE 4MDSA 1DE7H 1TX8A 1KMHB 3P8GA 1AD8H 3KQBA 2VIOA 5CHBA 1QBVH 1TRMA 4B75A 4B73A 1IHTH 3MHWU 6GCHF 2JJ1D 1EJAA 2A5IA 3UPEA 3LIWA 1TGBA 4U01A 4YXWD 4FUFA 3Q3KA 4IBLH 4AORA 1ZJKA 5LPFA 1A3EH 2JIZD 3RLWH 2QYIA 1TOCB 2VVVA 1DY9A 1QL8A 5HGGA 1OOKB 3BEIB 1KXBA 2W7SA 2P93A 3AVZA 5DP6A 5EG4A 1LHGH 1BQYA 3RXFA 3FAOA 8ESTE 2ZGBH 4SGBE 1QGFA 1O3PB 3DUXH 2ALVA 7GCHG 4M9FA 4WY3A 2G5NA 1MBQA 1CBWB 2ZTZA 1FAXA 5EXMA 4GHQA 1CHGA 3QWCH 2UUKB 1A61H 4UFDH 3IITA 1JMOH 3TNSA 3TLOA 1K28D 4DJZB 1AKSA 2AYWA 3SN8A 2XW9A 3OE7D 3VG8A 2QF4A 3A8CA 1Y3VA 3RXIA 1A2CH 1Y3WA 1MH0A 1W7GH 3OEHD 2A1DB 4XBCA 1KTTB 2PSXA 2HNTE 5JBTA 1W13U 4FOUC 1A0HB 3N99A 3TU7H 1T4VH 2WV4A 4Z0KA 3OTPA 3ZVEA 3TVJB 2QIQA 3UFAA 1E0FD 2ZPQA 1MTWA 6CHAC 1J9CH 1DLEA 2ZIQH 1GVKB 3TPIZ 3A85A 4BANB 2GCTB 1TNHA 1GBDA 3A84A 3ELAH 1ORFA 2QE7D 5E2PA 3W94A 1NC6A 3BEUA 3MO6A 2FOBA 4JZ1A 1O3GA 2PWXA 3ESTA 3PROA 1WYKA 4AYYB 4DOQA 4KKDA 1Z8RA 1MTVA 3EGKH 2H6MA 4A7IB 3PMAB 4X1RU 2W6JD 1S85A 1AFQC 1O3MA 3V0XA 1SC8U 3LGYA 5C5NA 4OGXA 3SV2H 3IWMA 1BTHH 1FJSA 2LELA 2JJ2D 2QN5T 3EA8A 2ZPRA 2WUBA 4UE7H 1C5WB 2SGAA 1PQ7A 4DIHH 3S9BA 2ZQ1A 1RJXB 1ARBA 4O3TA 3M5OA 7KMEH 1BJUA 3MNCA 3OFND 1THSH 1L2EA 3KQDA 3P8FA 4ZROA 4UD9H 4ISHH 2SGDE 1UTOA 4D7GA 2B5TB 3FP6E 5EW2H 3BEFB 3JZ2B 3BG4C 3UNSA 3RMMH 5AFYH 1NU7B 5T1VA 2BLWA 3LC5A 4YT6H 1PFXC 1F0TA 1AIXH 1ZHMA 3MI4A 2HWLB 1EJMA 2ZHEH 4INLA 1RD3B 3PLKA 3LU9B 1W0JD 1KXFA 1O37A 2KCYA 3M3VA 4IC6A 2BD7A 4TPYA 1DXPA 5EW1H 1Y8TA 3BTWE 2XTTB 3UIRA 2ZDAH 4ZHMU 3RXJA 4B2AA 1K1JA 2J38A 5FX5A 5A2MH 2ZU1A 3A81A 1FLEE 4Y0YE 3FANA 2W6ID 2V7QD 1COWD 1MKWH 2EA3A 2H5CA 3VGCC 2Y7ZA 3RMLH 1OWJA 2HNTF 2F9NA 5T6FA 1FI8A 5KEDA 2F3CE 4THNH 1EAXA 1P0SH 2A2XH 1F0SA 3BTKE 2Z9IA 2NWNA 1HJ8A 1SR5C 2C8XB 2ZGXH 1ZMJA 2M5TA 1HXEH 1LHCH 1SGDE 1BITA 1YF4A 1TWXB 1GJCB 1AWFH 4X1NU 1BA8B 4UFGH 1JOUB 4DIIH 2OQ5A 2A31A 2H9EH 2L74A 1IQFA 1L1JA 4AN7A 1F7ZA 1C5OH 2BDAA 4AFZA 1QB9A 5EODA 1FPCH 1FUJA 5FCRA 3A82A 1DPOA 3ZZ5A 2AGIX 3P6ZB 2OUAA 4WMFA 4X1SU 2Z6BD 4IC5A 3DD2H 1NTPA 3NK8A 4ZKOU 2BD2A 3ZZ7A 4XBBA 1AE8H 1TFXA 1C5UA 3TGIE 1T8OA 1GBMA 2JETC 4AYVB 1UVTH 4X8VH 4K1EA 2P3UB 2BOHB 1H8IH 5K0HA 4A5TS 1ZPCA 4GSOA 2BDCA 3P8NA 1SGRE 1BBRH 2FEQH 2ZQ2A 1O3OA 2I6QA 3HKIB 4WH8A 2ZECA 4ABJA 1FQ3A 2GCHG 1TPOA 3FP8E 2JH0D 1P05A 5GJ4B 3GY3A 2R0KA 2QXIA 3QK1A 3A88A 1GBCA 4NIXA 3RXAA 4E06H 4AZ2B 1GBAA 2ZFFH 1LMWB 4B74A 3GDSA 2PGQB 3F68H 3M5NA 2J98A 3RXMA 3GY7A 2QV1A 3MH7A 2AERH 2AGEX 3UQOA 3BSQA 3FVFB 4Q80A 5EGMA 2ZKSA 1DLKB 1BRUP 4IGDA 1OWEA 2WPHS 3RMOH 3SUDA 3VXEH 5CDFE 3U1JB 1EP5A 3EA7A 2ZU2A 2TIOA 2FI5E 1O5BB 1YP9A 3QTVH 5C5OA 1MD7A 5K7RA 4NFFA 4Y8XA 3FKSD 3QGNB 1P06A 1J15A 1MKWK 1SQAA 1N6YA 1HPGA 1TX6A 1YPLH 1MKXH 3OY6U 1GMHF 3KF2A 1OX1A 2BDIA 1ELTA 1B0FA 1EAIA 1HXFH 1O3EA 1DITH 1C2IA 1DDJA 5L2ZH 3M61U 2BX4A 2GT7A 4BTUB 1GDQA 1C9PA 4YO9A 4DCDA 1D3PB 1GJDB 1TBZH 2DE8A 2ASUB 3ZZAA 2AHME 4CBNA 4MNWA 1MTUA 1CT4E 1V2MT 4HGCA 2RA3A 2F4LA 3GCTF 5LPRA 3F0OA 1BMNH 1V3XA 3MH5A 5DKMA 1UVOA 4INKA 1THRH 5KGOA 3O8BA 1RTKA 1SVPA 1TMUH 1EUFA 2FM2A 2Y5FA 1E79D 2BLOA 5EIYA 1EOLA 3E6PH 2SFAA 1GBKA 3OSYA 3L3TA 3UREA 1AHTH 4Y10E 1BT7A 1IQLA 5FCKA 3LDXH 1TONA 4CH2B 5T6GA 2Q6FA 1JXPA 1ELAA 1Y5AT 2H9TH 3V12A 1HIAA 1GHAG 2WZQA 1QL9A 1O2TA 1FNIA 1EPTC 1SSXA 1AE5A 4HZHA 4NWLA 1GI1A 1TA2A 2P3TB 3JZ1B 1V2WT 3RM0H 2A2QH 3MH6A 1HAGE 2ODPA 3GYLB 1RRKA 3KNXA 1O5GH 1O2VA 4BAOB 1OYTH 1LHDH 1AO5A 2GZ7A 2C90B 2FTMA 4AX9H 1H8DH 1DUAA 2D2DA 2XBYA 2P8OC 5GDSH 1BTYA 2VIQA 1K1IA 2FS8A 3H5CB 1H8HD 3LGUA 1T7CA 3Q3YA 2VNTA 4AG2A 2FX4A 4D76A 1C5XB 2KCOA 4J1YA 1YY3A 1AZZA 2PFEA 5DN6D 1L1NA 4FVDA 2FODA 1SLWB 2AMPA 1ZHRA 3CENA 1D4PB 3OYPA 3ZV8A 1E1RD 3EAJA 5FX6A 1WCZA 2ZFTA 3BTGE 3KL6A 2VGCB 4AC9A 4B2CA 2ZPSA 2RA0A 1YYY1 3ATKA 4DVAU 4I8JA 4NFEA 2XC5A 2HNTC 1BRBE 1GI7B 2STBE 9LPRA 4Z6AH 2NU2E 3OU0A 5JBBS 3KHVA 5I46H 1MKXK 1VGCC 1ZZZA 4OM9A 5T6DA 5DP8A 1O2XA 3ZVGA 4F4OC 1O2PA 1CBWC 3LGVA 3M7QA 1NFWA 2K8IA 4X6NA 3ITIA 5EQQA 2XCNA 1NFYA 3BN9A 5PTPA 1SHYA 3IG6B 5E0HA 2BHGA 4QT8C 1YCPM 1VJ9U 2A0QB 3M7TA 2GZ8A 1PPFE 3SZEA 6GCHG 5DG6A 1RXPA 1F0RA 1UK2A 2W3IA 1SGYE 5AHGH 5EJZA 1CGHA 1MQ6A 3QUMP 3NCLA 2Y80A 3DA9B 3UNQA 1FIZA 2BZAA 1LHEH 3B23B 2XC4A 3HATH 1GI2A 3SJIA 1GG6B 2BZ6H 1SGQE 9ESTA 3OEED 2ZA5A 1V2VT 1LTOA 1P11E 1GBIA 1AB9B 3TIUA 3SU4A 1GGDB 1GI6A 1SGFA 2PSYA 3DFLA 5B6OA 3ODFA 4X2WA 2QF5A 5FPTA 3EYDA 3GY4A 3A8DA 3R3GB 3SJ9A 2V35A 2EQNA 1O2IA 3SU1A 3ZZBA 2GDDA 3T62A 5DJ7A 2KCAA 3HKJB 1Y3UA 1W12U 3GICB 3GS9A 4R0IA 1KSNA 3M3SA 4MNYA 3QTOH 4JZFH 4CR5A 1SQRA 2VWMA 4ASUD 1A46H 2WV9A 1NO9H 5JYIA 4CRBA 1XXDA 1IQNA 1KDQA 1TRNA 2TGPZ 4TY6A 3U8RH 1GI4A 3S69A 3SU3A 2BVXH 4I32A 1WOFA 2QGRA 3GCHB 1E1QD 3MTYA 1O3BA 1E34B 1OYQA 3AASA 3URDA 4CRAA 2IN2A 3AAVA 1FV9A 1BTPA 1KXAA 3LC3A 5EXNA 2R9PA 1GCTB 2PP6A 3A7YA 1QJ1B 1O5FH 4YESB 5FPSA 4BAHB 1IQMA 3SHAH 1HGTH 3FFGA 1J16A 2XNDD 3LH3A 2J92A 1YM0A 4I86A 1MD8A 1GVLA 1ZSKA 1NFXA 1O33A 2XWBI 3CS0A 3SJOA 1SLVB 4ISLA 2AFQB 2NU4E 2F43B 1TNLA 2Z9LA 1AU8A 5IDKA 1LCYA 1W8BH 4DURA 3STJA 3SV7A 4O3UA 2XBXA 1XVMA 1TGNA 2DUCA 1UTJA 3MNXA 1QR3E 4Z1MD 1O2RA 1C5YB 1LHFH 2FLBH 3Q3XA 4WMEA 1ETSH 2ZWLH 2V6NA 1QHRB 1UJ1A 2OQUA 3V7TA 4A6LA 1P8VC 4K1TA 3SHCH 1O32A 1ZPZA 1IQGA 1TIOA 5C3NA 1QIXB 1GJ7B 1GL1A 1MQ5A 1IQJA 3W1EA 1YLDA 5F8TA 1DT2A 4NG9H 3SNAA 3SQEE 1NN6A 2H5DA 1UVPA 1S81A 4ZHAA 2GMTB 6LPRA 4WVPE 1XUHA 2KFWA 1ELVA 1AKSB 1UHBB 2NU0E 4ABIA 4SGAE 4NIVA 1ZSLA 2YNAA 5C20A 1C1QA 1EZSC 2ZU5A 3SO3A 3MH4A 1Z7KA 2WPMS 1BIOA 2ILNA 1BHXF 3DFJA 3NPSA
chains in the Genus database with same CATH topology
1HDTH 5C67A 1FONA 3ZVFA 1GHZA 4HI3A 3UNRA 2A4GA 1S84A 1TQ0B 3M5LA 1OWDA 2ZFQH 1GDUA 3PLBA 3KN2A 2CHAB 2GDEH 1ELGA 1YPKH 4OS4A 1V2PT 1CGJE 1CHOF 2PUQH 5BRRE 4MTBA 2ZFPH 3RXDA 4Y11E 1XX9A 3UWIA 4Y6DA 4ABBA 3SGQE 3PMBB 1EB2A 1DWDH 1KYNA 1C1NA 4ZXXH 2ZHFH 5GCHG 1DFPA 4CH8B 1LPZB 1SGIB 3A7TA 5HMAA 1QB1A 1XVOA 5JBCS 1MAXA 5EQSA 2PV9B 3BG8A 4AGKA 2O8UA 2ZDVH 1P2KA 3RC6A 1GMCG 1GHYH 3RXTA 3PO1C 4TY7A 1GI8B 5GIBA 1GI5A 2QXJA 3T28A 1ZOMA 1QA7A 1X7AC 3GY5A 1IQEA 1UO6A 2BQ7B 2V0BA 4XOJA 3P8OA 1QFKH 1P2OA 2D1JA 1G3EA 1ZYOA 1OKXA 4MPVA 1IAUA 1A0JA 3K6YA 2ZU3A 4JK5A 2F9UA 1O2KA 1F5RA 2BQWB 4X0WU 2QAAA 1G30B 3DHKH 1NRSH 1CU1A 3L6PA 2FWWA 3H7TA 5C1XA 2VIVA 1Z6EA 3QO6A 2IJOB 3T25A 1UHBA 2BY5X 5L30H 1DVAH 1W2KH 1ZMLA 2K1QA 4WXIA 3TK5A 1C2JA 4H6SB 4WXVA 3VB4A 2PKSB 1ZGVA 3A86A 2FI3E 5DPAA 3SU0A 4FXGH 3Q77A 3TJOA 3LH1A 2ZDNA 1JBUH 1P2NA 1PQ8A 1AI8H 3BTDE 3GCOA 3T5FH 3K2UA 1C2FA 5E2OA 1WBGB 2A7HA 2D26C 5ESTE 1O2NA 1HV7A 1N8OB 3UR6A 1GMHG 3ZZ3A 1YLCA 4IW4E 2GP9B 1MTNB 4R8TB 1S82A 1SMFE 1M9UA 1CA0B 3I77A 1Q2WA 1TYNA 3PWCA 2PHBA 2Z9GA 4RKJB 3C1KA 1BRCE 3MNBA 4I8KA 4VGCC 4MQAA 1FAKH 5JPMH 2PW8H 4IN1A 1OXGA 5DP4A 1UTQA 3GCTG 3SNCA 1NZQH 3F9GA 2A4QA 1DM4B 3MU4A 4AB9A 5CHAB 1V2NT 1U6QA 1ELCA 4Y7BA 1AGJA 1T8MA 1HBTH 1NPMA 2A32A 8KME2 1XMNB 3LOXA 2HALA 3AW0A 1C2EA 2VGCC 4DW2U 4ZMAH 1C2HA 1TPAE 4LOYH 4FU7A 2OBOA 2OINA 4I31A 3SJKA 5A8YA 3P70B 1VCPA 5DP3A 8GCHG 1AN1E 4ZKSU 1TNIA 1D3DB 3GY8A 3SUGA 4ABGA 2GKVE 1OS8A 1OPHB 4GPGA 1TLDA 4CHAB 1DWEH 2GTBA 2P16A 1YPJH 2FP7B 1VITF 3E16B 4ABHA 3PB1E 3VB7A 2CN0H 4K2YA 1WV7H 1XUJA 2OC8A 1O31A 3LGTA 3MU5A 4DGJA 2ZTXA 2ZZUH 1MTSA 2LNCA 5FPYA 2H1UA 4JYUH 4AFQA 2ODYB 2G51A 3MNSA 1XKBC 3GCNA 2VVCA 3RXQA 3RXRA 1MBMA 1BB0B 1GG6C 2BMGB 1JIMA 1KLIH 1FXYA 1O3CA 2I6SA 3UWJH 4CRFA 1NS3A 3BV9B 3M7UA 2VH0A 3SU2A 1GGDC 4NA9H 2A45B 5GCHF 1XUIA 2G00A 3AAUA 2SGPE 1V2UT 2Q6GA 1HYLA 1V2ST 1WTGH 1DSUA 4MPXA 2XBWA 2XXLA 1DANH 3HPTB 3VPKA 1XKAC 2IOTA 5C1YA 3UQVA 1GMCF 1PYTD 3SQHE 2BD9A 3FZDA 3BTHE 1EQ9A 4J2YB 3TK9A 1Z1JA 1L0ZA 4X6OA 2G4TA 3VB6A 2QA9E 1C5LH 1Z1IA 2A5AA 3OY5U 4ZUHA 3SNBA 1TABE 3RDZA 1LKAA 1DY8A 1HIAB 2FLRH 1EZQA 2JH5D 1IQIA 5HM9A 2C8YB 4OS7A 1V2LT 2QXGA 3V3MA 3RXPA 3RC5A 1S0RA 2HVXA 1O5DH 1Y5BT 2ANYA 2R0LA 1RIWB 3BIVH 1C5MD 5C2ZA 1SFIA 3KIDU 2ZHDA 1Y3YA 1NRRH 1GCTC 4D9QA 1XXFA 3SUFA 2G8TA 1ESTA 3MO3A 1QTFA 1HAIH 1V2TT 2CF9H 3RP2A 3ZVDA 1NM6A 1TA6A 1C5ZB 5A8XA 1TBQH 3TH3H 1NRPH 3MU8A 1CO7E 3L33A 3P95A 2WYGA 3BTQE 4M7GA 2EI7A 2AEIH 3M36A 1ELBA 5JDUB 4Y0ZE 1MCVA 4UFEH 2FX6A 2ZHWH 1GHVH 1OP0A 5EPNA 1BOQA 3UR9A 4ABDA 1JIRA 2UWPA 4BXSA 3SW2B 4RSPA 4X8SH 1L4ZA 1FN8A 1IQHA 4MVNA 1PPHE 4OS1A 1O3LA 4FU9A 1KXDA 4FUEA 1ZTLA 3QN7A 4I8GA 2ZCKP 2AIQA 4ZHLU 4X8UH 1TOMH 2KAIA 3O8DA 4JZIA 1FPHH 1GJ8B 1C5NH 1B7XB 1A5HA 3GY2A 1PJPA 1Y59T 3E90B 4H6TA 5DK1A 1G2MA 1O3IA 1TBRH 2FOGA 1YGCH 4K8BA 1S6FA 3MFJA 1QQUA 3Q00A 1HAVA 1PPZA 1LPGB 1W14U 1NU9A 2CGAA 3M37A 4KTCA 2CHAC 5DGJA 3M5MA 8GCHF 1GJ4H 3SBKA 1WQSA 1ZRBA 4BTTB 1CGIE 2O8LA 2AGGX 1QRZA 4BTIB 5F6MA 1XUGA 1GWAA 2FOEA 4XBDA 1C1TA 4KTSA 1Q3XA 1ZGIA 2AH4X 2ZO3H 4D8NA 1EOJA 3O8RA 4YZUA 4RKOB 1ZSJA 4Y71A 4UFFH 3SNEA 2BDGA 2SNVA 4Y79A 1QL7A 4CRGA 4AB8A 3A7VA 1KDQB 1N6XA 3I78A 1BUIA 4OGYA 1HAPH 2Z3EA 3D65E 5A8ZA 1HLTH 2STAE 4KTUA 1SHHB 2HGTH 4WJG2 3A89A 2GV7A 2RCEA 1W3CA 1AFQB 2THFB 2Y81A 1TGTA 4MNXA 3SZNA 4JCNA 4D9RA 1J17T 5GPIB 4U32A 2PKAA 5BPEA 1L1GA 1DICA 1ESAA 3T27A 1HJAB 3EQ0H 1TX7A 1QB6A 1MU6B 3F9FA 1GBLA 4X1QU 1C5PA 3F6UH 3BTME 1RFNA 1CHOG 4PROA 3MU0A 3K6ZA 3MYWA 3BG4B 1V2OT 2CF8H 3RMNH 2VIWA 2OC1A 4JK6A 1O39A 4I7YH 4B2BA 1BTZA 4XE4A 1XM1A 2HOBA 2O8TA 1CA8B 1INCA 3MOCA 2FYRA 1O2WA 2WPIS 3S9AA 4FUGA 3QZRA 1C1MA 1SGNE 2NU1E 1KLJH 3PWBA 2BD8A 2VJ1A 4MPUA 2ZNKH 1FY8E 1FZZA 4ABEA 1AZ8A 2Y6TA 1GHBF 2C8WB 4YOGA 1BRAA 1SGPE 2BD3A 3ENSB 1HAZB 3ATIA 3U1IB 2A4OA 1QJ6B 1VR1H 2ZTYA 3ZV9A 1B0EA 1YPGH 3VGCB 2Z7FE 2WUCA 1UTKA 1G3CA 3D23A 2GCTC 1S0QA 3A8AA 4U2WA 2G5VA 4GCHF 2FOFA 2BQ6B 1MTNC 2ZCHP 2ZGCA 1S83A 2Z9JA 3O8CA 1P57B 1FDPA 5CE1A 3STIA 1EP6A 1P2IA 3HK3B 5AFZH 4A1XA 2WPJS 1C1RA 2GGVB 1K2I1 3TNTA 4K5ZA 1C2MA 2ALPA 1GJAB 1THPB 4GUXA 3RC4A 5E8EH 1YPMH 4FUBA 3K65B 1C4Y2 1A3BH 5FHTA 1MCTA 3LT3A 1GBEA 1VJAU 1UCYH 3ZZ9A 1PYTC 2RDLA 3SGAE 2CV3A 1GI9B 1SGTA 2ZFRH 4B1TA 2O8WA 3UOUA 1C5QA 5AF9H 2FXRA 1S6HA 1OP2A 4ABFA 2XYAA 2QF0A 1E35B 3HGPA 1C1SA 2F9PA 2YOLA 2FIRH 1C4V2 5EOKA 2GV6A 4CHAC 3GOVB 1O2ZA 1ID5H 4YOIA 3S7KB 1HJ9A 2GD4B 1PPBH 1TNJA 3MWIU 3ZVBA 2B0FA 1AY6H 1LVYA 1FY1A 2BYAX 2UUFB 1C4U2 1K1LA 1P2JA 1PQ5A 1C1VH 1IOEA 1AVWA 2FS9A 4D7FA 2FOAA 3SOSA 3TH4H 4XFQA 2FI4E 4O03A 1PPEE 4A1TA 4TWWA 1ZJDA 4Q7XA 5GXPA 1LQDB 4BAMB 1NESE 3UOPA 3A8BA 3EA9A 4IMZA 2C3SA 4YTAA 4BXWA 1QNJA 1AWHB 1MUEB 1VITH 1T8NA 1O2LA 1JWTA 5SGAE 1RGQA 2BTCE 2BVSH 2J2UA 5DO4H 5AVDA 1EZXC 4ZH8A 1WQVH 2OC7A 2R3YA 3RXCA 1SOTA 3RXSA 2OTVA 1GHWH 2OBQA 5JB9S 1ZPBA 2ANWA 1EZUC 1VITG 3LGWA 7ESTE 1E37B 1ANDA 1NROH 1AVXA 2VWLA 4Q7YA 2IPHA 2UWLA 2BD5A 4H42U 3N7OA 1ZTKA 4NA7A 4NCYA 3I29A 1KXCA 1QBOA 4ISIH 3E91A 4X2XA 4ASHA 2R2MB 1A7SA 2Y7XA 3S7HB 2Z3DA 1LPKB 4UDWH 4FUCA 5HM2A 1MAYA 1RIWC 1UCYK 1A1RA 1CSOE 1SBWA 4Q7ZA 1TPPA 1UCYE 1F2SE 1ETTH 3RXHA 1ETRH 3T26A 1P09A 4JMYA 2ANKH 1EPTB 4ZKNU 1ZTJA 1QCPA 1GI0A 1C1UH 3QZQA 3S0NA 4JZDH 5DP9A 2WPKS 4LZ4B 4FUHA 1LO6A 2W7UA 1WSSH 1DX5M 3M35A 1XUFA 1K9OE 2PGBB 2ZGJA 1B5GH 3A7ZA 4Q2KA 1SGCA 1QRWA 2ZGHA 4U30A 2HPPH 3KQEA 1HAHH 1V2QT 1LKBA 1O2OA 2V3HH 4ZKRU 2TPIZ 2P8OB 3OX7U 1P04A 3NZIA 2C4FH 4NSYA 3SORA 1C2DA 1QJ7B 5EQRA 1UTLM 3B8JA 1O5EH 2CXVA 2B8OH 1O5AB 1C2GA 2B9LA 2VH6A 1NFUA 2PUXB 2ZFSA 2QF3A 4AFUA 1AVGH 5GWZA 1O3FA 3RXEA 1IHSH 1E36B 1P9SA 1J14A 4IMQA 1XUKA 5DP5A 1NRQH 2FPZA 2FOHA 2O8MA 1V2JT 4BAKB 1F5LA 1GBFA 4DG4A 2F91A 1ZR0A 2ANMH 2SGEE 1MZDA 5ABWA 1VGCB 1AFEH 5J4SA 5LPEA 1P02A 1W11U 2G81E 2QY0B 5IYTA 2NU3E 5HXFA 5FAHA 1GCDA 1O3HA 1P2MA 1C9TA 3ZZ8A 1FMGA 1G36A 1O2YA 2ODQA 1F5KU 1NT1A 3VB3A 1HAYB 2VB0A 2ESTE 1OWKA 1F0UA 1S5SA 2HRVA 4NIWA 1BZXE 1TNKA 1LVOA 2BX3A 3BTFE 3V13A 4AOQA 4K60A 1ZRKA 1V2RT 3BTTE 5E0GA 1NY22 1O0DH 5FBEA 5EXLA 3EE0B 3RU4T 4OS2A 1O2UA 3TH2H 4XDEA 1FIWA 1YC0A 4HTCH 1EPTA 1C2LA 2LPRA 2BXUH 2J34A 1TMTH 1ANCA 5FBIA 3FP7E 2F9OA 1QBNA 3NWUA 3RU4E 1K1OA 2J4IA 1O2JA 2PTCE 2R3UA 1GMDG 2TGDA 3E0NB 3LKWA 4HFPB 1BDAA 1G9IE 5E0JA 1SI5H 1W7XH 2ZG0H 3AW1A 4X6MA 4JYTA 2UWOA 5L6NH 4JZEH 2VU8E 4X8TH 1VCWA 3HK6B 1HJAC 1SFQB 1TMBH 1K22H 1GVZA 1HNEE 1K21H 2D8WA 2FYQA 2BVRH 3P92A 4CRCA 2FDAA 4NGAH 4MG3A 3RU4D 2G52A 2XWAA 4A1VA 1QA0A 2OCVB 5C1UA 2XC0A 1RTLA 1UK3A 3RXUA 1DUEA 4FVBA 3RXKA 1HFDA 1RS0A 1QRXA 2P95A 8LPRA 4NZQA 1T8LA 4AFSA 2J9NA 3D62A 1QQ4A 3KQCA 1SQOA 3RLYH 2FTLE 1D6WA 3TGKE 5A0CA 1GJBB 3ATMA 6ESTA 3U8OH 3SV6A 4O9VA 1MZAA 1KY9A 5LH8A 1AB9C 1OWIA 1Z8IB 1TGSZ 2BM2A 2XNIA 1BMLA 1Z8JB 4XSKU 4UEHH 4GAWA 4FU8A 3RXBA 1H9LB 2BLVA 5ESBA 4KP0A 1ELFA 3GDVA 3A83A 4B71A 1OP8A 1P9UA 2R2WU 2KAIB 1GDNA 1W0YH 1J8AA 3A80A 2GVFA 2BXTH 2PLXA 1ANEA 1O2HA 4Y8YA 2QXHA 2HLCA 4MLFB 4CBOA 1IQKA 3KGPA 2XCFA 1N1LA 3NUMA 4NA8A 2FMJA 4NWKA 3F9EA 1C2KA 3RM2H 2Q1JA 2FOMB 4RN6A 3GCHC 1ABIH 1HAVB 3VEQB 3F9HA 2AMQA 1C5SA 2W5EA 1GHBG 1WU1A 1C1WH 2F9BH 1F92A 2UUYA 4BOHA 4UONA 2BB4A 4ISOA 1SOZA 1FY4A 1HRTH 1P03A 1UVSH 3KEEA 3SGBE 3ZZCA 4GCHG 1AUTC 4BAQB 2CJIA 4GHTA 4Y76A 5F8ZA 1T32A 1OSSA 2ZEBA 3TGJE 7GCHF 1T4UH 2O9QA 3RXOA 2VIDA 1LVBA 1BTXA 4I8HA 3DT0H 1W10U 3VB5A 1GJ9B 1K1NA 2BOKA 3BF6H 4ISNA 1DOJA 5J4QA 3EDXB 4O97A 3T2NA 3FZZA 2P3FH 1CT2E 3PMHB 4ESTE 1SLUB 1UK4A 1O3DA 2ULLA 4E05H 2C93B 1Q31A 2TGAA 2PKAB 1YPHE 1SGFG 4X2YA 1P12E 4K8YA 3PO1B 5TCCA 4I33A 1TPSA 1DSTA 1GI3A 3TJNA 1SGEE 4TWYA 5JBAS 4KGAA 1DS2E 1O2SA 4LZ1H 2OXSA 3UY9A 2ZC9H 1MU8B 1A0LA 2GMTC 2BY9X 2JKHA 1Y5UT 2AMDA 2H9HA 2WINI 2OC0A 1GMDF 1VCQA 2Z3CA 4WWYA 3GYMA 4K3JA 4IN2A 1FN6A 1P2QA 4INHA 3ZVCA 1OWHA 4BNRA 1O3JA 3R0FA 2HPQH 5T3HA 2Y82A 2VIPA 3CP7A 3LONA 2TBSA 2XRCA 4YT7H 2BY7X 3SV9A 2SNWA 1GBBA