1A0LA

Human beta-tryptase: a ring-like tetramer with active sites facing a central pore
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
244
structure length
244
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords BETA-TRYPTASE
total genus 50
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 1997-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a0lA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a0lA01
2OXSA 4Y11E 4ISHH 4IBLH 2W5EA 2B7DH 1CGHA 1QRZA 1O39A 1CT2E 4SGBE 2LNCA 1S82A 1GDQA 5GIBA 4YESB 3RXCA 1VJAU 2HNTC 4YT7H 1BDAA 1ZMLA 2QIQA 1ZJKA 3QZQA 3LC5A 2PLXA 4GCHF 1QFKH 1TNLA 5L2YH 2GCHG 3PYHA 1CA8B 5FHTA 1WV7H 1BB0B 2XRCA 3LGYA 4WY3A 3CENA 4X2XA 1MTNC 3TJUA 1BJUA 1E35B 2GT7A 1W12U 2Q6FA 3TVJB 3ZZ3A 1YPGH 4LOYH 4IMQA 3M3VA 2BDBA 3WY8A 1OOKB 2ASUB 3GYLB 3SBKA 1SC8U 1YPHE 2WUCA 4IC6A 1HAIH 1KLTA 1GJ7B 4YM9A 1A61H 1MCVA 3TITA 2K1QA 1NZQH 1ZPZA 2HGTH 3EA8A 2ZFRH 1JOUB 1KXFA 3BTWE 3QGJA 8GCHF 3EQ0H 3GCTF 2PSYA 4KELA 4LK4A 1ETTH 2CF8H 1O2XA 1OWDA 3T28A 2AH4X 1GHXH 2QN5T 2TIOA 3F6UH 2P59A 5TCAA 1EB2A 1K1PA 3V13A 1VGCC 1A4WH 1TAWA 4AX9H 1HAGE 2VIDA 5EQSA 4AG1A 1ZTLA 1D6WA 2ZFPH 1TA2A 4KTUA 4CRAA 1V6DA 4XBDA 1ZOMA 3V7TA 4X1SU 3QWCH 4ISNA 4CRDA 1CA0B 1O2WA 1JRTA 4XBBA 5A09A 4K5ZA 2GZ9A 1L2EA 1CE5A 2PKSB 4JZ1A 1S6FA 3T29A 4KP0A 1P3CA 1TOMH 5BRRE 2ZDNA 2C8XB 1F2SE 1O3GA 1RTKA 3FVFB 5F03A 3SV6A 4NA9H 3LH1A 3Q3YA 4X8TH 1KLJH 2THFB 1OWHA 2F9OA 2SNVA 2F9NA 3A7WA 3SJ9A 3EA9A 2V3HH 1O2TA 2R0LA 1JMOH 2JH0D 1RIWB 3RXBA 1GI1A 1GPZA 3ZZ4A 1GI3A 1ELEE 1T8MA 2Q1JA 4FUHA 4AFUA 4MNVA 1EOLA 1AE5A 1H9HE 1GBEA 4RSPA 2OD3B 4WMFA 2RCEA 2J94A 3TH4H 1FN8A 2P8OB 3SNBA 5IYTA 5DP3A 3MNCA 1TBQH 2ZC9H 3L3TA 1BIOA 3GDSA 2O9QA 1W0ZU 1C4V2 1F5LA 1HIAA 2QYIA 3Q76A 2SGAA 3P92A 1QHRB 1GGDB 3ZVFA 2CV3A 3UFAA 4CH8B 1NTPA 1TMTH 2FLRH 1CHOG 2ZGJA 3D49H 1TBRH 1ETRH 1C5LH 4F4OC 1BRAA 1SGRE 1LKBA 1O38A 1LDTT 2PTNA 1OX1A 4ZHAA 3VXFH 1A0JA 3GY2A 1QL8A 2BQWB 2I6SA 1HAPH 3BG4C 4KKDA 1NRRH 1C1QA 2FS8A 4Y7BA 1AMHA 1UTLM 2BXUH 1PQ5A 4A6LA 2ZO3H 2FYQA 1CHGA 3UR9A 2Z9LA 1V2ST 3RMNH 3RXLA 5JB9S 5IDKA 3R3GB 1QL9A 1DDJA 2Y6TA 1AD8H 2QCYA 4NFFA 2FPZA 2FOMB 1HJ9A 3Q00A 2XW9A 3ESTA 1CA0C 1F7ZA 1ZTJA 5C1YA 3HK3B 2ZHFH 4HGCA 4NG9H 1K1OA 1SGIB 3MH5A 4I33A 7GCHF 1DPOA 3TU7H 1IHTH 1TNJA 2A7CA 2C8YB 1KXAA 2PW8H 1K28D 2CHAC 1MD8A 2ZHQH 2ZGCA 1GJ5H 1TYNA 2BDAA 1O3PB 3RUOA 4FVBA 7GCHG 3K2UA 4H6SB 1OKXA 2WV5A 5A8YA 3PLBA 3HGNA 2ODQA 3KQDA 1A5HA 1EZUC 5JYIA 1WSSH 1Y5BT 2BZ6H 1SGCA 1F0UA 2FOBA 1WCZA 1PYTD 2V6NA 2BDGA 4JZFH 1WQSA 1XUJA 3IITA 1J9CH 1AE8H 4DVAU 4IC5A 1UTKA 2ANWA 1B7XB 1SQTA 4AZ2B 5C1UA 1BCUH 1UCYE 2XC5A 3BTQE 1YGCH 1E36B 1OP2A 4UE7H 2H9TH 1EOJA 3M37A 3SU2A 2BMGB 1ZMNA 3TJVA 5F8XA 4YOIA 1DWEH 1SI5H 4NIVA 4E7NA 2VVCA 1GDNA 4YOGA 3SQEE 4CR5A 1MBMA 1XUFA 1GVKB 1GBFA 3SV8A 1W2KH 4WVPE 4BOHA 1RFNA 3FZZA 1W7GH 1Z1JA 2FP7B 4AGKA 2GV7A 1UK4A 3KEEA 3DHKH 3SNEA 2ZHWH 1SBWA 1RJXB 3PTBA 1A46H 1EJMA 4BTUB 4MTBA 5G4BA 5GXPA 1MKXK 1G3DA 1FXYA 1GI2A 7ESTE 1D3DB 1WU1A 1YPMH 2A5IA 2BXTH 1P10A 3MU0A 1GMCG 5EPNA 1OYQA 1Z6JH 2YNBA 5TJXA 3V0XA 4AFQA 3A87A 3SHCH 1K1JA 1C1RA 2XBXA 3M5NA 1N8OB 4R8TB 3K65B 2H9HA 2G8TA 1KY9A 2IN2A 1BHXB 4D8NA 1QA7A 8LPRA 3U69H 2ALPA 2ZFFH 2WYJA 1SGNE 3GOVB 5L6NH 2H5CA 4A7IB 2PV9B 4I8KA 5FPSA 1NFWA 2JETC 3ATMA 2ZNKH 2BQ7B 2NU0E 2JKHA 2OTVA 1AUJA 1ZSKA 3UIRA 3UTUH 1GBLA 3F9HA 1FY5A 1K22H 1SLUB 2OC1A 4AB9A 4HI3A 3SJOA 1UK2A 3ENSB 3PWBA 1CVWH 5EG4A 3KGPA 4Y10E 2GD4B 5JBBS 2BVXH 2P95A 1THPB 1UVSH 1SGTA 1PPBH 1FLEE 4ABDA 1QA0A 1UVOA 2F9PA 4GPGA 3O8CA 3D23A 3ZZBA 3QLPH 3CS7A 3O8RA 4CHAC 1AIXH 2C3SA 1A1RA 2FTLE 4KTSA 3V12A 3ATIA 2D8WA 1ZHPA 1O34A 1W10U 3UWIA 1MUEB 1GBHA 3HKIB 2XCNA 2Y5FA 3KNXA 1FPCH 1VCQA 4NZQA 3OY5U 3S69A 1RTFB 9ESTA 5DP4A 5AFYH 1C2GA 4YOJA 1BTXA 1MKWK 5ETXA 3LH3A 4GLYA 1V2UT 2Z7FE 4WMDA 4GHQA 1BMNH 4MDSA 2WPHS 3RM2H 1FY1A 1UMAH 1F5KU 2WUBA 2YOLA 4Y7AA 3MH7A 4B2AA 1C1OA 1QCPA 3ATWA 1UO6A 5C20A 1QURH 1PPFE 2B5TB 5FX5A 4LZ4B 1XM1A 3GCHB 1J15A 1H1BA 2R9PA 3RXUA 1DY9A 3E0NB 1Y8TA 3G01A 1C1PA 1HIAB 1BUIA 2Y81A 1Z7KA 1SQAA 3QX5H 2EEKA 2AYWA 3LU9B 1IAUA 1O5BB 3QN7A 1K21H 5EOKA 4FU9A 4NWKA 1HBTH 5GCHG 1KXEA 3ZVBA 3B8JA 4A92A 1LPZB 1AQ7A 2YNAA 1ELTA 1G36A 2V0BA 2KAIB 1P57B 1O2JA 1P3EA 1ZRKA 2EA3A 4JMYA 2ZCLP 4DCDA 1EJAA 2GT8A 5EW2H 1FY4A 2XXLA 1AI8H 1FIZA 3RXSA 1GJBB 3SU0A 2FZZA 3KQCA 1AFQC 1Y3VA 2BLOA 3KN2A 1XUIA 1PPEE 1QNJA 2BX4A 1TB6H 1O36A 2G81E 4KTCA 3A7ZA 4Q7XA 3LGUA 1DVAH 4ISOA 5K7RA 2BD2A 4ABIA 1H9LB 1V2NT 2EI7A 2TGPZ 3SU4A 4TWWA 3NPSA 5DGJA 1SFQB 4AORA 1G3BA 2QF3A 3NCLA 8ESTE 1UCYH 3F9EA 1TIOA 1C5QA 4ISIH 3RXOA 4YZUA 2F9UA 2H6MA 3SZNA 5C5OA 1TFXA 2TGDA 1S5SA 1V2WT 4FU8A 4B2BA 4GCHG 1ELBA 4Y6DA 1CO7E 1G9IE 1PQ7A 2GX4A 4YT6H 1AKSA 1UTMA 5ESBA 3RXRA 1IQGA 1GMCF 1B0EA 4RKJB 4B75A 1DY8A 2A31A 2J4IA 1IQJA 1BRBE 2CHAB 3GICB 4YLQH 1AB9C 1BQYA 4Y8XA 3UNSA 3STIA 2B0FA 2BVSH 2ZZUH 5JPMH 2A0QB 1TQ0B 2A7HA 3P8GA 2XTTB 1C2EA 3M61U 1O5EH 2ULLA 2HALA 4OS5A 3M36A 3SJKA 5L2ZH 3HATH 2OC0A 3TJNA 2Z3DA 2VVVA 1Q31A 1H8DH 4MPVA 3RXEA 1C1NA 3LJOA 3IWMA 2VIVA 5E0JA 1DS2E 3ZYDA 2XNIA 1O3HA 1JWTA 3A7VA 3RU4T 3VB3A 3NUMA 1C5OH 1ZGVA 2AGEX 3LGVA 2R2MB 1GJ4H 3Q77A 2BB4A 1RTLA 1O33A 1NS3A 1ZZZA 1FY3A 3A85A 1GI4A 2OBQA 3JZ2B 1C1MA 4K3JA 4I7YH 2ZTYA 1V2VT 3NZIA 1UVPA 2ANYA 2RG3A 1JIRA 4B74A 4B73A 3LT3A 4UONA 1ZSLA 3T27A 1RGQA 2B9LA 3RMMH 3URDA 3A89A 2STBE 3FFGA 4CRGA 1O32A 5TCCA 4MVNA 4ZMAH 1QL7A 1HAVB 3M5MA 2ZGXH 2FI3E 2Y80A 3VB6A 4AYVB 2HNTF 1IQHA 4ZHLU 2ANMH 2A2QH 3AAUA 1F0TA 3S0NA 4I31A 3SU1A 3PV4A 2TGTA 6LPRA 1K1LA 3A7YA 4Q80A 4JK5A 2AMDA 1E37B 1SOZA 1K1IA 2R0KA 4UDWH 1TOCB 1P03A 1O3NA 2ZDMA 2HRVA 1E0FD 1QJ1B 4IGDA 1QBNA 1QRWA 1ZHMA 3A7XA 3PMHB 3DD2H 2G51A 1DXWA 3SNAA 1V2TT 1SB1H 1WAYB 2QAAA 4K8YA 1FAXA 2ZG0H 2RDLA 1BA8B 1L4DA 1C4U2 4WMEA 1GBKA 4X2YA 4NSYA 1GMHF 2J2UA 2QA9E 2UUFB 2ZU2A 3M7TA 1O3BA 4NA8A 1O2GH 1TRMA 5DP7A 3MO3A 1IOEA 3AW0A 1DOJA 2ILNA 3U9AH 1HXEH 2XCFA 4YTAA 1HV7A 4IS5A 2FXRA 1X7AC 4X6OA 1S0RA 1AWFH 1OWKA 3EGKH 1BTHH 3OU0A 3ZZ6A 1SGYE 4Y8YA 1ELGA 4TYDA 3VPKA 4ISLA 3MFJA 3U8OH 4K1EA 5LPEA 1QB6A 2JETB 3TLOA 1FIWA 5T3HA 4FUIA 2A1DB 1P09A 3UREA 4BTTB 3BTHE 4RKOB 1O2VA 5A0AE 1DICA 1NFXA 1XXFA 4ZXXH 1T8NA 2G52A 2ZCKP 3EAJA 1C5PA 3ZZ8A 5I25A 1O3EA 2ZTXA 1N8OC 4FVDA 5AHGH 1Y3YA 1K1NA 5F8ZA 3MHWU 5EODA 1NRNH 1OP8A 3VGCC 3SU3A 1KSNA 1MTUA 1ZPCA 1LVYA 2SGQE 2AGGX 1Z8GA 5T6GA 3RXDA 1O5AB 2VIPA 1O3FA 1BITA 3QK1A 1EAIA 4AGJA 1D9IA 3EA7A 1GBCA 2QXGA 1IQEA 2ZFTA 2SNWA 2JH5D 1MH0A 1XVOA 5A8XA 2VH0A 2ESTE 3RLYH 3TNTA 2OUAA 3TNSA 4FUFA 1P11E 1H9IE 1GBTA 2ZDVH 3A86A 1J16A 1P06A 3S9BA 2C93B 1NFYA 1C2LA 2UUJB 1TLDA 2G5VA 2BY7X 3EDXB 1ZMJA 1FQ3A 1UHBA 3GY4A 3T62A 4B2CA 1O31A 1P05A 1F0RA 5DPAA 3RMLH 1O0DH 2SGFE 2PHBA 2O8LA 3NXPA 5HM2A 1UTQA 1Z71A 2G4TA 4ABAA 3RXJA 2VIQA 3A80A 3ZVDA 4CRFA 1EB1H 1GI6A 2BD4A 1A2CH 3FP7E 2ZI2H 4Y71A 3DUXH 3LJJA 3HGPA 2J92A 3QZRA 4YLUA 5ESTE 4TPYA 2ZU5A 1C2MA 1IQLA 1ELCA 3TH3H 1VITF 2BD5A 2FLBH 2SGDE 1FN6A 2P16A 2CJIA 1S85A 3MNSA 3N7OA 3UNQA 1W8BH 1XUHA 4DIHH 4INLA 1VZQH 5JDUB 1EZQA 2ZQ1A 2BLQA 1MQ6A 1GL0E 1NFUA 1XVMA 1NY22 1O3JA 3E1XB 1GCTB 3NK8A 1UTNA 1HAYB 3B23B 5C5NA 1LO6A 7KMEH 3ZV9A 2V35A 1EAWA 1B0FA 4CREA 3U98H 2NWNA 1QTFA 3U1JB 4GHTA 1UTOA 2PUXB 3RXVA 2GMTB 3ZZ5A 1LPKB 1C2IA 1S6HA 1O2LA 3A8AA 1JIMA 3SUFA 1QQUA 4X8SH 1LHGH 3H7OA 1G3EA 1HB0B 4WWYA 5EQQA 2BQ6B 4B76A 1SQOA 4D9QA 4UD9H 3QTVH 1TNGA 2BM2A 2HVXA 5LH8A 1P2OA 1WBGB 1VR1H 2A45B 1GHBF 1C5SA 1KXBA 1YYY1 1O3IA 2DE8A 2BOHB 3SNCA 1YF4A 4ZKSU 3RDZA 4ZKRU 1GHBG 1GBBA 4DT7B 5PTPA 2W7UA 4SGAE 1SLWB 1GVZA 1P2MA 3U1IB 2HWLB 1EX3A 1W0YH 2OINA 2BVRH 2FOFA 5DKMA 4INKA 2J95A 4Y8ZA 1GHWH 1ANDA 4OS7A 1DM4B 1GJDB 1GHYH 1LHDH 1PFXC 4X1NU 1O2ZA 1PPGE 1MKWH 4YO9A 3PWCA 1ORFA 3KQEA 2GCTC 2XBWA 2PKSC 1FV9A 1CQQA 5K0HA 1SHHB 1D3PB 3RC6A 1FI8A 3VB5A 1C5ZB 1IQFA 3M5OA 1J17T 3BTME 1AB9B 1O3DA 4NCYA 3BV9B 1BBRE 3MU5A 1O2YA 1AKSB 1EUFA 1TPAE 2Z3EA 4I8LA 3SHAH 2O8UA 1IQKA 3HK6B 4FU7A 1AY6H 2CN0H 2Z9IA 1F0SA 3F68H 1AVXA 5GCHF 1ELFA 3BEIB 3V3MA 2PUQH 3KCGH 1SGFG 3GY5A 4JZIA 5AFZH 1KLIH 3AVZA 4UFFH 8KME2 1BRUP 4UEHH 2IJOB 4ABEA 1TNIA 1T8OA 4K1TA 2GKVE 4K69A 1SOTA 4A1VA 4NGAH 1DUAA 1GI7B 4BAHB 4FUBA 3RU4D 2FS9A 3M3TA 1AFQB 1HGTH 1ZSJA 1GHVH 2QV1A 1VCPA 2V3OH 3E8LA 1P9UA 5EQRA 3NKKA 1YKTA 3D65E 4IN1A 1GMDG 4OS6A 2HPPH 2I6QA 2XYAA 3PLKA 1PJPA 2W26A 3A84A 3QUMP 3SI3H 3QTOH 1TRNA 1BMMH 9LPRA 2TGAA 2VB0A 1FUJA 1TMUH 1XUGA 1G3CA 1MKXH 4Y79A 4JCNA 2D26C 4ABFA 2OC8A 1QGFA 1MTNB 3ZZ9A 3SUGA 3PROA 1O2KA 1Z6EA 1O2OA 1OP0A 2XBYA 4FXGH 2TRMA 1MQ5A 1GWAA 4NWLA 1A5GH 1C5NH 1HAVA 1O5GH 1YBWA 1TWXB 1MU6B 2DE9A 5JBTA 3A82A 1YP9A 3BF6H 2NU4E 2F9BH 2FYRA 3ZVAA 1FDPA 4X8UH 4AB8A 2BD3A 2ODYB 3GDVA 1D4PB 4IW4E 3FP8E 4NIYA 1TX8A 1WTHD 3M7UA 4TWYA 4NIWA 1CSOE 1MZAA 1FZZA 4BAMB 2ZPSA 5A2MH 5DP6A 4A1TA 1T31A 3VB4A 1YCPK 1Z8RA 1GJAB 1ZJDA 1EJNA 3ZZCA 3ODFA 2WPJS 3F1SB 5EPYA 2AEIH 1TX7A 1CT0E 1SLXB 3LGIA 1INCA 1YCPH 1IQMA 2ZDKA 3SO3A 4NSVA 1EPTB 1LTOA 4ZUHA 4UFGH 1ESAA 3SORA 1HNEE 1O2UA 3LC3A 3ZV8A 4XE4A 4AFZA 1W13U 1YLDA 4VGCB 1Y3WA 1ANBA 1TA6A 3UWJH 1P02A 3TGJE 4H42U 2XWBI 4AN7A 3AAVA 5JBCS 1PPHE 4AOQA 1C5VA 4BAQB 1EASA 3FAOA 3OTJE 3RMOH 1T4UH 3ODDA 2FIRH 4JK6A 1RXPA 1HFDA 4X8VH 3M7QA 1W3CA 2XC4A 2QF0A 1TPSA 2P3TB 2OQ5A 1SFIA 3RXPA 4CHAB 4MPXA 4BAOB 3SOSA 4ABJA 1BBRK 2VH6A 3C1KA 3PO1C 3BTGE 1KDQB 3SU5A 5C2ZA 1H8IH 2PWXA 2ZA5A 3CS0A 1WTGH 4R0IA 4H6TA 3SUEA 4NIXA 5SGAE 3D62A 3F9GA 1MTVA 5HYOA 5FBIA 1G30B 1UTJA 4WH6A 2PGQB 4MQAA 3BIVH 4IMZA 3PO1B 2ZIQH 4B71A 1O3LA 1O3MA 5T6DA 3ELAH 1SR5C 4VGCC 1FONA 2QGRA 1TGTA 3UNRA 1BRCE 4Y0ZE 3F9FA 3LIWA 2SFAA 1E34B 1OPHB 1XKAC 1QY6A 3BTFE 1IQIA 1FY8E 1TRYA 4GVUA 5LPFA 1AGJA 1GBJA 2ZPQA 1FJSA 2A4RA 2A32A 2UUKB 4I8GA 4WF8A 4DURA 1J14A 3RU4E 1Q3XA 3FZDA 1TABE 2P93A 3UUZA 2Y5HA 4TY6A 5T6FA 1S84A 3MU4A 5DO4H 4AYYB 1O2MA 4CH2B 2PR3A 1KTTB 2AMQA 2BY6X 4X2VA 1SSXA 3GY3A 1LHEH 3O8DA 1ZPBA 1O5DH 1TONA 1O2PA 1OSSA 1UHBB 1UVTH 5C1XA 1QRXA 4UFDH 2HOBA 2BX3A 2GP9B 1O2IA 2QXJA 2DUCA 1BT7A 2FO9A 3OSYA 1G2MA 1GCDA 3JZ1B 1JXPA 1DSTA 1YPHC 2F3CE 3ITIA 1VITG 2H5DA 4A1XA 3RXFA 1FNIA 3Q3KA 1O3OA 3A7TA 4Z0KA 3OY6U 3SUDA 1P04A 3FANA 1DXPA 1IQNA 1O30A 3W95A 2UUYA 2XC0A 3PB1E 2FTMA 1GHAG 1NRSH 1MD7A 2O8MA 1EKBB 1TPOA 4RN6A 1V2LT 2NU2E 3IG6B 4BNRA 2D1JA 2AERH 1EQ9A 2FDAA 5E2PA 5HXFA 4D9RA 4ZROA 2ZHEH 2IPHA 5CMXH 1Q2WA 1YPEH 1GMHG 4WJG2 5FX6A 3H7TA 1YPLH 4FUJA 1XUKA 1W7XH 3K9XB 6CHAC 1C2HA 2ALVA 3SJIA 1NU9A 2TPIZ 2WINI 1JRSA 4F49A 1F5RA 2Z9KA 1DT2A 3HKJB 4XFQA 2Z6BD 1C5YB 1L0ZA 2A4QA 1BMLA 2ZEBA 1HAHH 1DFPA 1XMNB 1BTWA 2J38A 1DANH 3MOCA 1OXGA 4DG4A 4D76A 2KAIA 4ZH8A 2C90B 1CGJE 1SPJA 1SLVB 1V2KT 2Y7XA 3E3TA 1NC6A 2O8WA 1O3KA 3TIUA 5EXNA 2FWWA 4IN2A 3E91A 3TK5A 1B5GH 1AHTH 4JYTA 1A3EH 3FP6E 3RC4A 3TGIE 1TPPA 2QXIA 3BSQA 4I32A 4OS1A 1YM0A 2ZGBH 3VFEA 3LGWA 2VWOA 4JYVH 1FPHH 1VITH 1GMDF 2BD8A 1J8AA 3TJOA 3URCA 4HTCH 5J4QA 2ZPRA 3K6ZA 3LOXA 1YC0A 2ZF0H 5I46H 1L1NA 2TBSA 2Y7ZA 2WPIS 1Y5UT 2FOHA 3MH6A 4GSOA 2ZFSA 5DJ7A 4XOJA 3DT0H 1SGEE 5E0GA 4DW2U 1RRKA 1C5TA 1A5IA 5DK1A 1GI8B 1BTPA 1MAXA 1HDTH 3MU8A 2FOCA 4MNYA 5HGGA 2F83A 1AVGH 1P12E 1HJ8A 2EI6A 2RA0A 2UWOA 4ZKNU 3I78A 5FCRA 3BG4B 2C4FH 1BZXE 1BHXF 1GI0A 4MPUA 4D7GA 3ZZAA 3P17H 3SW2B 3MI4A 2BDCA 1BMAA 1S0QA 3M35A 2VGCC 1DITH 1EP6A 2ZFQH 3UPEA 2G5NA 1LVMA 2ZTZA 1MZDA 1O3AA 2VIOA 2VNTA 4WH8A 2WPMS 3UOPA 1P8VC 2GV6A 2FESH 1TGBA 2F9VA 1ELAA 5J4SA 1C4Y2 1D6RA 1HLTH 5FPTA 3TK6A 2FI5E 4X6MA 1HAXB 4BAKB 5LPRA 2P8OC 3U8TH 4THNH 5HM9A 3LKWA 3S9AA 1L1GA 1MU8B 1V2PT 1ESBA 3VXEH 2HLCA 3MU1A 4K1SA 2FM2A 5FBEA 1T4VH 1V2QT 1ZYOA 1RIWC 4BXWA 5F8TA 4X1RU 2AIPA 2STAE 2FOGA 3P95A 1QB9A 1K2I1 1VJ9U 2NU3E 1ABJH 2G00A 4NA7A 5ABWA 1JBUH 3QO6A 1Y3UA 1S81A 1O2RA 4CRBA 1P01A 2R2WU 3M5LA 1D3QB 1GHAF 4OGYA 2A4OA 3EE0B 1UCYK 2BDIA 4MG3A 2HPQH 4PROA 3LONA 5EXLA 2OQUA 1BTYA 2GMTC 1GBAA 1HRTH 1O5CB 1P2IA 1OS8A 2CF9H 4CBNA 4B1TA 1P2NA 1V3XA 3P8NA 4UFEH 1E38B 3C27B 1VGCB 1HJAB 4ZKOU 1AU8A 2GCHF 3KHVA 1YPKH 2VJ1A 1GBMA 2Y5GA 1KIGH 1YCPM 1V2OT 1ZTKA 4LZ1H 2Q6GA 1ARCA 3T5FH 3BEUA 1LCYA 4TY7A 4FUEA 1TE0A 1Z1IA 1XKBC 4U30A 1QBVH 4X6PA 2FEQH 1C5WB 2ZKSA 3E6PH 1DLKB 1AO5A 3RP2A 1EZXC 2R3YA 1DSUA 1ID5H 2FX6A 3LPRA 2VWNA 3E16B 1CBWC 2OBOA 3STJA 1PQAA 3RC5A 2H2ZA 3GISB 3RXIA 5L30H 2ZGHA 1EAUA 4BANB 1LQDB 1V2RT 3PMJA 2ZU3A 1RD3B 2W3IA 2D2DA 3RXKA 1M9UA 5AF9H 2VWLA 5DP8A 3RXGA 3GDUA 1LQEA 1DWDH 5A0BA 2GZ7A 1C1SA 1SG8B 2GGVB 4X0WU 2ANKH 2ODPA 2A5KA 4U01A 1OWEA 1HPGA 5B6OA 3GCOA 4GAWA 2BYAX 3L6PA 3BG8A 3CP7A 2FI4E 3VGCB 2WPKS 2O8TA 5E8EH 1BTUA 1TMBH 5GWZA 1NO9H 1P9SA 2M5TA 1MMJN 1ZGIA 4ZXYH 1D3TB 5JBAS 4NFEA 1MTWA 1NN6A 3QGNB 1SL3A 1TNHA 2BDHA 3GCTG 1EP5A 3MO6A 1UK3A 5C3NA 3GCNA 4ABGA 1SMFE 1G32B 2B8OH 1TGSZ 2BLVA 4MLFB 1C1VH 3MMGA 3MYWA 6GCHG 1ETSH 2ZQ2A 3SJ8A 3RM0H 4ASHA 1Y5AT 4AG2A 1EAXA 2A2XH 1AWHB 3UY9A 3ZZ7A 2BHGA 1CBWB 1L4ZA 4K2YA 3PM3A 3P6ZB 2C8WB 5C67A 2OP9A 1KDQA 3B9FH 1RS0A 1O35A 1K9OE 2AFQB 3UOUA 3SQHE 3LDXH 1SGDE 1VCWA 2GTBA 2P3UB 5FXLA 1CT4E 3LGTA 2VINA 3I77A 1AN1E 1O2SA 4U32A 3ZYEA 1ACBE 2BD7A 4OS4A 3GY6A 2ZDAH 3A81A 4E7RG 2OC7A 1ANCA 2VWMA 1AVWA 3QDZB 1HJAC 1DLEA 2RA3A 3OYPA 4KGAA 3PMAB 1THRH 1U6QA 5E2OA 1HAOH 3ZZDA 1GBIA 1NRPH 5GPIB 1N6XA 1FMGA 1N1LA 3S9CA 4INHA 4WXVA 4DOQA 1TNKA 4K8BA 1C2JA 2P3FH 2PTCE 2LPRA 1DWBH 4FUDA 1ZR0A 3BTEE 2A4GA 2A7JA 5FCKA 1A0LA 5GDSH 1LVOA 1AUTC 2BDYA 4MNXA 4ESTE 4FUCA 4O9VA 5CHAB 3BTTE 4BTIB 1PPZA 2IOTA 1WYKA 3H5CB 2BY9X 4DGJA 4ABHA 5A8ZA 2R3UA 1DX5M 4FUGA 1ELVA 3P70B 1EPTC 4ZHMU 3RXAA 7LPRA 1GJ8B 1QJ7B 3SGBE 1NT1A 2QY0B 1LVBA 5CE1A 3SN8A 5E0HA 1Y59T 1ESTA 1SVPA 2ZU1A 1P2KA 2XWAA 3A83A 1MAYA 4LXBH 3A8DA 2AMPA 3GY8A 4Y76A 1BTZA 3SU6A 1SGQE 2ZWLH 1OWIA 3BTKE 5GJ4B 3NWUA 1GGDC 2FMJA 1QJ6B 3W94A 5EGMA 2CGAA 3MO9A 1OYTH 4MNWA 1QB1A 2G4UA 2Z9JA 3SGQE 2SGPE 1MBQA 1MCTA 1N6YA 4JYUH 4ABBA 1P2QA 4OGXA 3RXHA 3ZVGA 3RXTA 4XSKU 5EU8A 1ELDE 1CGIE 3SV9A 1BOQA 4XBCA 1O3CA 3ZVEA 1Z8IB 1Y3XA 4DY7B 2GDEH 2C8ZB 4QT8C 1HCGA 2VGCB 4Y0YE 4E06H 1GL1A 4Q2KA 1O2HA 2Q6DA 5HMAA 1P0SH 2VIWA 5DP5A 3GY7A 2F91A 3ATLA 1GVLA 2PSXA 3EYDA 2CXVA 5H4IB 1S83A 4U2WA 1ZRBA 2FOAA 4NZLA 2ZHDA 1GG6C 1NROH 1C5RA 3P8FA 3RXQA 1CU1A 3M3SA 1F92A 3P8OA 6GCHF 3S7KB 4E05H 1ABIH 1QQ4A 1XX9A 1W11U 3PTNA 8GCHG 3MNXA 1DUEA 5EXMA 2P94A 4XDEA 3AASA 1BJVA 1C5MD 1C9PA 1QBOA 3BN9A 2BY8X 3RLWH 2Z9GA 3I29A 1GDUA 4TPIZ 2W3KA 1WOFA 2WPLS 1YLCA 2W7SA 3MH4A 2QC2A 1C5UA 1GJCB 3AW1A 1A7SA 2BOKA 1O2QA 1C2DA 2WV4A 4O97A 3KQBA 2ZCHP 2FX4A 1T8LA 2Y82A 4HFPB 5BPEA 3U8RH 2ZP0H 1HXFH 1W14U 3VB7A 1PQ8A 3KL6A 1HUTH 2AGIX 1EPTA 3RXMA 3TGKE 1NM6A 1A3BH 4I8JA 2H1UA 4CR9A 1GG6B 4A5TS 1HAZB 1DWCH 4X1QU 2EC9H 4H4FA 3K6YA 5FAHA 1K1MA 2OCVB 1GI5A 2VU8E 1KXDA 4X2WA 5F6MA 4CRCA 4M7GA 2GCTB 1C2KA 5DG6A 2FOEA 3BEFB 6CHAB 1AZZA 1GI9B 1V2JT 3SV7A 1KYNA 5AVDA 3UQOA 3GYMA 1WUNH 4ZAEA 1NESE 1H4WA 3SGAE 3SI4H 4D7FA 2BD9A 2QXHA 2HNTE 2PKAA 1SHYA 4JZEH 2H9EH 1LPGB 1FAKH 1NU7B 3DA9B 1AZ8A 4GUXA 4CBOA 3S7HB 3T26A 4J2YB 1GHZA 3GCHC 5A0CA 1KXCA 1C2FA 1NRQH 4HZHA 4Q7YA 2PGBB 2J34A 3PMBB 3UQVA 2BY5X 1MTSA 1ZLRA 2OLGA 5LGOA 4Q7ZA 2VVUA 4X6NA 2FODA 2AIQA 1AFEH 2G55A 2SGEE 5JB8S 3E90B 3VEQB 3BIUH 1TGNA 3HPTB 1PPCE 4Z6AH 1SGPE 1XXDA 3TPIZ 1C1UH 1O37A 3KF2A 3UR6A 1GBDA 1TGCA 2GDDA 4I8HA 2Z3CA 3PLPA 4O3TA 2BZAA 3T25A 3BTDE 1O2NA 2EI8A 1PYTC 1TALA 1UJ1A 4OS2A 1QR3E 1Z8JB 2WYGA 1TQ7B 2PFEA 4K60A 3MTYA 2J9NA 3MWIU 1P2JA 5CHAC 1CHOF 2A5AA 1T7CA 1BBRH 3MNBA 2PKAB 1QIXB 2AS9A 1ZHRA 1LHFH 1GCTC 1UVUH 3A88A 4DJZB 3ZVCA 3KIDU 1LHCH 3DFLA 1EZSC 3O8BA 1WQVH 1YPJH 3OX7U 1ANEA 3SV2H 4WXIA 1LMWB 2XBVA 1T32A 1SGFA 1O5FH 2UWLA 1C9TA 4DIIH 4JZDH 3L33A 1C1WH 3A8CA 2GZ8A 1GJ6A 6ESTA 1L1JA 2GVFA 1GJ9B 5FPYA 2NU1E 4AFSA 1IHSH 1THSH 3R0FA 1OWJA 2BLWA 2JH6D 1C5XB 1UTPA 3E0PB 1HYLA 4BXSA 5DP9A 1C1TA 3ATKA 1G37A 3Q3XA 5EW1H 4MPWA 1EXFA 3T2NA 1V2MT 2UWPA 3DFJA 4O03A 1G2LA 2Z94A 3A8BA 2BTCE 2ZECA 1A0HB 2CMYA 1NPMA 1KTSB 4J1YA 4O3UA 3TH2H 2ZDLA 1EATA 1DE7H 1LKAA 3SNDA 1TBZH 1ARBA 3TK9A 4X1PU 1TX6A 2ZU4A
chains in the Genus database with same CATH superfamily
2OXSA 3DSPA 4Y11E 4ISHH 4IBLH 2W5EA 2B7DH 1CGHA 1QRZA 1O39A 1CT2E 4Z1MD 4SGBE 2LNCA 1S82A 1GDQA 2LP6A 5GIBA 4YESB 3RXCA 1VJAU 2HNTC 3FOAA 4YT7H 1BDAA 1ZMLA 2QIQA 1ZJKA 3QZQA 3LC5A 2PLXA 4GCHF 1QFKH 1TNLA 5L2YH 2GCHG 3PYHA 1CA8B 5FHTA 1WV7H 1BB0B 2XRCA 3LGYA 4WY3A 3CENA 4X2XA 1MTNC 3TJUA 1BJUA 1E35B 2GT7A 1W12U 2Q6FA 3TVJB 3ZZ3A 1YPGH 4LOYH 4IMQA 3M3VA 2BDBA 3WY8A 5HIYA 1OOKB 2ASUB 3GYLB 3SBKA 1SC8U 1YPHE 2WUCA 4IC6A 1HAIH 1KLTA 1GJ7B 5GNDA 3WWBA 4YM9A 3MQKC 1A61H 1MCVA 4RT1A 3TITA 2K1QA 1NZQH 1ZPZA 2HGTH 3EA8A 2ZFRH 1JOUB 1KXFA 3BTWE 3QGJA 8GCHF 3EQ0H 3GCTF 2PSYA 4KELA 4LK4A 1ETTH 2CF8H 1O2XA 1OWDA 3T28A 2AH4X 1GHXH 2QN5T 2TIOA 3F6UH 2P59A 5TCAA 1EB2A 1EFRD 1K1PA 3V13A 1VGCC 1A4WH 1TAWA 4AX9H 1HAGE 2VIDA 5EQSA 4AG1A 1ZTLA 1D6WA 2ZFPH 1TA2A 4KTUA 4CRAA 1V6DA 4XBDA 1ZOMA 3V7TA 4X1SU 3QWCH 4ISNA 4CRDA 1CA0B 1O2WA 1JRTA 4XBBA 5A09A 4K5ZA 2GZ9A 1L2EA 1CE5A 2PKSB 4JZ1A 1S6FA 3T29A 4KP0A 1P3CA 1TOMH 5BRRE 2ZDNA 2C8XB 1F2SE 1O3GA 1RTKA 3FVFB 5F03A 3SV6A 4NA9H 3LH1A 3Q3YA 4X8TH 1KLJH 2THFB 1OWHA 2F9OA 2SNVA 2F9NA 3A7WA 3SJ9A 3EA9A 2V3HH 1O2TA 2R0LA 1JMOH 2JH0D 1RIWB 3RXBA 1GI1A 1GPZA 3ZZ4A 1GI3A 1ELEE 1T8MA 2Q1JA 4FUHA 4AFUA 4MNVA 1EOLA 1AE5A 1H9HE 1GBEA 4RSPA 2OD3B 4WMFA 2RCEA 2J94A 3TH4H 4TSFD 1FN8A 2P8OB 3SNBA 5IYTA 5DP3A 3MNCA 1TBQH 2ZC9H 3L3TA 1BIOA 3GDSA 2O9QA 1W0ZU 1C4V2 1F5LA 1HIAA 2QYIA 3Q76A 2SGAA 3P92A 1QHRB 1GGDB 3ZVFA 2CV3A 3UFAA 4CH8B 1NTPA 1TMTH 2FLRH 1CHOG 2ZGJA 3D49H 1TBRH 1ETRH 1C5LH 4F4OC 1BRAA 1SGRE 1LKBA 2QE7D 1O38A 1LDTT 2PTNA 1OX1A 4ZHAA 3VXFH 1A0JA 4DT4A 3GY2A 1QL8A 2BQWB 2I6SA 3UB0A 1HAPH 3BG4C 4KKDA 1NRRH 1C1QA 2FS8A 4Y7BA 1AMHA 1UTLM 2BXUH 1PQ5A 4A6LA 2ZO3H 2FYQA 1CHGA 4I86A 3UR9A 2Z9LA 2J97A 1V2ST 3RMNH 3RXLA 5JB9S 5IDKA 2M2AA 3R3GB 1QL9A 1DDJA 1KMHB 2Y6TA 1AD8H 2QCYA 4NFFA 2FPZA 2FOMB 1HJ9A 3Q00A 2XW9A 3ESTA 1CA0C 1F7ZA 1ZTJA 5C1YA 3HK3B 2ZHFH 4HGCA 4NG9H 1K1OA 1SGIB 3MH5A 4I33A 7GCHF 1DPOA 3TU7H 1IHTH 4P02A 1TNJA 2A7CA 2C8YB 1KXAA 2PW8H 1K28D 2CHAC 1MD8A 2ZHQH 2ZGCA 1GJ5H 1TYNA 2BDAA 1O3PB 3RUOA 4FVBA 7GCHG 3K2UA 4H6SB 1OKXA 2WV5A 5A8YA 3PLBA 3HGNA 2ODQA 3KQDA 1A5HA 1EZUC 5JYIA 1WSSH 1Y5BT 2BZ6H 1SGCA 1F0UA 2FOBA 1WCZA 1PYTD 2V6NA 2BDGA 4JZFH 1WQSA 1XUJA 3IITA 1J9CH 1YWUA 1AE8H 4DVAU 4IC5A 1UTKA 2ANWA 1B7XB 1SQTA 4AZ2B 5C1UA 1BCUH 1UCYE 2XC5A 3BTQE 1YGCH 1E36B 1OP2A 4UE7H 2H9TH 1EOJA 3M37A 3SU2A 2BMGB 1ZMNA 3TJVA 5F8XA 4YOIA 1DWEH 1SI5H 4NIVA 4E7NA 2CK3D 5HKKD 2VVCA 1GDNA 4YOGA 3SQEE 2KX4A 4CR5A 1MBMA 1XUFA 1GVKB 1GBFA 2K0QA 4XD7D 3SV8A 1W2KH 1E79D 4WVPE 4BOHA 1RFNA 3FZZA 1W7GH 3AK5A 1Z1JA 2FP7B 4AGKA 2GV7A 1UK4A 3KEEA 3DHKH 3SNEA 2ZHWH 3H09A 1SBWA 1RJXB 3PTBA 1A46H 1EJMA 4BTUB 4MTBA 5G4BA 5GXPA 1MKXK 1G3DA 1FXYA 1GI2A 7ESTE 1D3DB 1WU1A 1YPMH 2A5IA 2BXTH 3SYJA 1P10A 3MU0A 1GMCG 5EPNA 1OYQA 1Z6JH 2YNBA 5TJXA 3V0XA 4AFQA 3A87A 3SHCH 1K1JA 1C1RA 2XBXA 3M5NA 1N8OB 4R8TB 3K65B 2H9HA 2G8TA 1KY9A 2IN2A 1BHXB 4D8NA 1QA7A 8LPRA 3U69H 2ALPA 2ZFFH 2WYJA 2W6JD 1SGNE 3GOVB 5L6NH 2H5CA 4A7IB 2PV9B 4I8KA 5FPSA 1SKYE 4RT0A 1NFWA 2JETC 3ATMA 2ZNKH 1WXRA 2BQ7B 2NU0E 2JKHA 2OTVA 1AUJA 1ZSKA 3UIRA 3UTUH 1GBLA 3F9HA 3OFND 1FY5A 1K22H 1SLUB 2OC1A 4AB9A 4HI3A 3SJOA 1UK2A 1YLNA 3ENSB 5F53A 3PWBA 2JDID 1CVWH 5EG4A 3KGPA 4Y10E 2GD4B 5JBBS 2BVXH 2P95A 1THPB 1UVSH 1SGTA 1PPBH 1FLEE 4ABDA 1QA0A 1UVOA 2F9PA 4GPGA 3O8CA 3D23A 3ZZBA 3QLPH 3CS7A 3O8RA 4CHAC 2KR7A 1AIXH 2C3SA 1A1RA 2FTLE 4KTSA 3V12A 3ATIA 2D8WA 1ZHPA 1O34A 1W10U 3UWIA 1MUEB 1GBHA 3HKIB 2XCNA 2Y5FA 3KNXA 1FPCH 1VCQA 4NZQA 3OY5U 3S69A 1RTFB 9ESTA 5DP4A 5AFYH 1C2GA 4YOJA 1BTXA 1MKWK 5ETXA 3LH3A 4GLYA 1V2UT 2Z7FE 4WMDA 4GHQA 1BMNH 4MDSA 2WPHS 3RM2H 1FY1A 1UMAH 1F5KU 2WUBA 2YOLA 4Y7AA 3MH7A 4B2AA 4F48B 1C1OA 1QCPA 3ATWA 1UO6A 5C20A 1QURH 1PPFE 2B5TB 5FX5A 4LZ4B 1XM1A 3GCHB 1J15A 1H1BA 2R9PA 3RXUA 1DY9A 3E0NB 1Y8TA 3G01A 1C1PA 1HIAB 1BUIA 2Y81A 1Z7KA 1SQAA 3QX5H 2EEKA 2AYWA 3F3BA 3LU9B 1IAUA 1O5BB 3QN7A 1K21H 5EOKA 4FU9A 4NWKA 1HBTH 5GCHG 1KXEA 3ZVBA 3B8JA 4A92A 1LPZB 1AQ7A 2YNAA 1ELTA 1G36A 2V0BA 2KAIB 1P57B 1O2JA 1P3EA 1ZRKA 2EA3A 4JMYA 2ZCLP 4DCDA 1EJAA 2GT8A 5EW2H 1FY4A 2XXLA 1AI8H 1FIZA 3RXSA 1GJBB 3SU0A 2FZZA 3KQCA 1AFQC 1Y3VA 2BLOA 3KN2A 1XUIA 1PPEE 1QNJA 2BX4A 1TB6H 1O36A 2G81E 4KTCA 3A7ZA 4Q7XA 3LGUA 1DVAH 4ISOA 5K7RA 2BD2A 4ABIA 1H9LB 2YMSC 1V2NT 2EI7A 2TGPZ 3SU4A 4TWWA 3NPSA 5DGJA 1SFQB 4AORA 1G3BA 2QF3A 3NCLA 8ESTE 1UCYH 3F9EA 1TIOA 1C5QA 4ISIH 3RXOA 4YZUA 2F9UA 2H6MA 3SZNA 5C5OA 1TFXA 2TGDA 1S5SA 1V2WT 4FU8A 4B2BA 4GCHG 1ELBA 4Y6DA 1CO7E 1G9IE 1PQ7A 2EY4C 2GX4A 4YT6H 1AKSA 1UTMA 5ESBA 3RXRA 1IQGA 1GMCF 1B0EA 4RKJB 4B75A 1DY8A 2A31A 2J4IA 1IQJA 1BRBE 2CHAB 3GICB 4YLQH 1AB9C 1BQYA 4Y8XA 3UNSA 2YMSD 3STIA 2V3MA 2B0FA 2BVSH 2ZZUH 5JPMH 1VKYA 2A0QB 1TQ0B 2A7HA 3P8GA 2VBCA 1C2EA 2XTTB 3M61U 1O5EH 2ULLA 2HALA 4OS5A 3M36A 3SJKA 5L2ZH 3HATH 2OC0A 3TJNA 2Z3DA 2VVVA 1Q31A 1H8DH 4MPVA 3RXEA 1C1NA 3LJOA 3IWMA 2VIVA 5E0JA 1DS2E 3ZYDA 2XNIA 1O3HA 1JWTA 3A7VA 3RU4T 3VB3A 3NUMA 1C5OH 1ZGVA 2AGEX 3LGVA 2R2MB 1GJ4H 3Q77A 2BB4A 1RTLA 1O33A 1NS3A 1ZZZA 3DSOA 1FY3A 3A85A 1GI4A 2OBQA 3JZ2B 4ACAA 2L6OA 1C1MA 4K3JA 4I7YH 2ZTYA 1V2VT 3NZIA 1UVPA 2ANYA 2RG3A 1JIRA 4B74A 4B73A 3LT3A 4UONA 1ZSLA 3T27A 1RGQA 2B9LA 3RMMH 3URDA 3A89A 2STBE 3FFGA 4CRGA 1O32A 5TCCA 4MVNA 4ZMAH 1QL7A 2KM0A 1HAVB 3M5MA 2ZGXH 2FI3E 2Y80A 2QF5A 3VB6A 4AYVB 2HNTF 1IQHA 4ZHLU 2ANMH 2A2QH 3AAUA 1F0TA 3S0NA 4I31A 3SU1A 3PV4A 2TGTA 6LPRA 1K1LA 3A7YA 4Q80A 4JK5A 2AMDA 1E37B 2KCPA 5DN6D 1SOZA 1K1IA 2PP6A 2R0KA 4UDWH 1TOCB 1P03A 1O3NA 2ZDMA 2HRVA 1E0FD 1QJ1B 4IGDA 1QBNA 1QRWA 1UW7A 1ZHMA 3A7XA 3OE7D 3PMHB 3DD2H 2G51A 1DXWA 3SNAA 1V2TT 1SB1H 1WAYB 2QAAA 4K8YA 1FAXA 2ZG0H 2RDLA 1BA8B 1L4DA 1C4U2 4WMEA 1GBKA 4X2YA 4NSYA 1GMHF 2J2UA 2QA9E 2UUFB 2ZU2A 3M7TA 1O3BA 4NA8A 3F2GA 1O2GH 1TRMA 5DP7A 3MO3A 1IOEA 3AW0A 1DOJA 2ILNA 3U9AH 1HXEH 2XCFA 4YTAA 1HV7A 4IS5A 2FXRA 1X7AC 4X6OA 1S0RA 1AWFH 1OWKA 3EGKH 1BTHH 3OU0A 3ZZ6A 1SGYE 4Y8YA 1ELGA 4TYDA 3VPKA 4ISLA 3MFJA 3U8OH 4K1EA 5LPEA 1QB6A 2JETB 3TLOA 1FIWA 5T3HA 4FUIA 2A1DB 1P09A 3UREA 4BTTB 3BTHE 4RKOB 4RI0A 1O2VA 5A0AE 1DICA 1NFXA 1XXFA 4ZXXH 1T8NA 1K0HA 2G52A 2ZCKP 3EAJA 1C5PA 3ZZ8A 5I25A 1O3EA 2ZTXA 1N8OC 4FVDA 5AHGH 1Y3YA 1K1NA 5F8ZA 3MHWU 5EODA 1NRNH 1OP8A 3VGCC 3SU3A 1KSNA 1MTUA 1ZPCA 1LVYA 2SGQE 2AGGX 1Z8GA 5T6GA 3RXDA 1O5AB 2VIPA 1O3FA 1BITA 3QK1A 1EAIA 4AGJA 4YXWD 1D9IA 3EA7A 1GBCA 2QXGA 1IQEA 2ZFTA 2SNWA 2JH5D 1MH0A 1XVOA 5A8XA 2VH0A 2ESTE 3RLYH 3TNTA 2OUAA 3TNSA 4FUFA 1P11E 1H9IE 1GBTA 2ZDVH 3A86A 1J16A 1P06A 3S9BA 2C93B 1NFYA 2RFKC 1C2LA 2UUJB 1TLDA 2G5VA 2BY7X 3EDXB 1ZMJA 1FQ3A 1UHBA 3GY4A 3T62A 4B2CA 1O31A 4ZCNA 1P05A 1F0RA 2J5UA 5DPAA 3RMLH 1O0DH 2SGFE 2PHBA 2O8LA 3NXPA 5HM2A 1UTQA 1Z71A 2G4TA 4ABAA 3RXJA 2VIQA 3A80A 3ZVDA 4CRFA 1EB1H 1GI6A 2BD4A 1A2CH 3FP7E 2ZI2H 4Y71A 3DUXH 3LJJA 3HGPA 2J92A 1NBME 3QZRA 4YLUA 5ESTE 4TPYA 2ZU5A 1C2MA 1IQLA 1ELCA 3TH3H 1VITF 2BD5A 2FLBH 2SGDE 1COWD 1FN6A 2P16A 2CJIA 1S85A 3MNSA 2J98A 3N7OA 5FL7D 3UNQA 1W8BH 1XUHA 4OM9A 4DIHH 4INLA 1VZQH 5JDUB 1EZQA 2ZQ1A 2BLQA 1MQ6A 1GL0E 2W6ID 1NFUA 1XVMA 1NY22 1O3JA 3E1XB 1GCTB 3NK8A 1UTNA 1HAYB 3B23B 5C5NA 1LO6A 7KMEH 1OHHD 3ZV9A 2V35A 1EAWA 1B0FA 4CREA 3U98H 1W0JD 2KCAA 2NWNA 1QTFA 3U1JB 4GHTA 1UTOA 2PUXB 3RXVA 2GMTB 3ZZ5A 1LPKB 3DCLA 1C2IA 1S6HA 1W0KD 1O2LA 3A8AA 1JIMA 3SUFA 1QQUA 4X8SH 1LHGH 3H7OA 1G3EA 1HB0B 4WWYA 5EQQA 5KEDA 2BQ6B 4B76A 1SQOA 4D9QA 4UD9H 3QTVH 1TNGA 2BM2A 2HVXA 5LH8A 1P2OA 1WBGB 1VR1H 2A45B 1GHBF 1C5SA 1KXBA 1YYY1 1O3IA 2DE8A 2BOHB 3SNCA 1YF4A 5B6LA 4ZKSU 3RDZA 4ZKRU 1GHBG 1GBBA 4DT7B 5PTPA 2W7UA 4SGAE 1SLWB 1GVZA 1P2MA 3U1IB 1QZ8A 1EX3A 1W0YH 2HWLB 2OINA 2BVRH 2FOFA 3N7EA 5DKMA 4INKA 1MABB 2J95A 4Y8ZA 3KQ5A 1GHWH 1ANDA 4M9FA 4OS7A 1DM4B 1GJDB 1GHYH 1LHDH 1PFXC 4X1NU 1O2ZA 1PPGE 1MKWH 4YO9A 3PWCA 1ORFA 3KQEA 2GCTC 2XBWA 2PKSC 1FV9A 1CQQA 5K0HA 1SHHB 1D3PB 3RC6A 1FI8A 3VB5A 1C5ZB 1IQFA 3M5OA 3ZIAD 1J17T 3BTME 1AB9B 1O3DA 4NCYA 3BV9B 1BBRE 3MU5A 1O2YA 1AKSB 1EUFA 2RDEA 1TPAE 2Z3EA 4I8LA 3SHAH 2XOKD 2O8UA 1IQKA 3HK6B 4FU7A 5EJZA 1AY6H 2CN0H 2Z9IA 1F0SA 3F68H 3PRDA 1AVXA 5GCHF 2KFWA 1ELFA 3BEIB 3V3MA 2PUQH 3KCGH 1SGFG 3GY5A 4JZIA 5AFZH 1KLIH 3AVZA 4UFFH 8KME2 1BRUP 4UEHH 2IJOB 2WV9A 4ABEA 2HLDD 1TNIA 1T8OA 4K1TA 2GKVE 4K69A 1SOTA 4A1VA 4NGAH 1DUAA 1GI7B 4BAHB 4FUBA 3RU4D 2FS9A 3EE7A 3M3TA 1AFQB 1HGTH 1ZSJA 1GHVH 2QV1A 1VCPA 2V3OH 3E8LA 1P9UA 5EQRA 3NKKA 1YKTA 3D65E 4IN1A 1GMDG 4OS6A 2HPPH 2I6QA 2XYAA 4FETA 4ASUD 2XNDD 3PLKA 1PJPA 2W26A 3A84A 3QUMP 3SI3H 4P00A 3QTOH 1TRNA 1BMMH 9LPRA 2TGAA 2VB0A 1FUJA 1TMUH 1XUGA 1G3CA 1MKXH 4Y79A 4JCNA 2D26C 4ABFA 2OC8A 1QGFA 1MTNB 3ZZ9A 3SUGA 3PROA 1O2KA 1Z6EA 1YY3A 1O2OA 1OP0A 2KCYA 2XBYA 4FXGH 2TRMA 1MQ5A 1GWAA 4NWLA 1A5GH 1C5NH 1HAVA 1O5GH 1YBWA 1TWXB 1MU6B 2DE9A 5CHBA 3A82A 1YP9A 3BF6H 2NU4E 5JBTA 2F9BH 2FYRA 3ZVAA 1FDPA 4X8UH 4AB8A 2BD3A 4ACBA 2ODYB 3GDVA 1D4PB 4IW4E 3FP8E 4NIYA 1TX8A 1WTHD 3M7UA 4TWYA 4NIWA 1CSOE 1MZAA 1FZZA 4BAMB 2ZPSA 5A2MH 5DP6A 4A1TA 1T31A 3VB4A 1YCPK 1Z8RA 1GJAB 1ZJDA 1EJNA 3ZZCA 2F43B 3ODFA 2WPJS 3F1SB 5EPYA 2AEIH 1TX7A 1CT0E 1SLXB 3LGIA 1INCA 1YCPH 1IQMA 2ZDKA 3SO3A 4NSVA 1EPTB 1LTOA 4ZUHA 4UFGH 1ESAA 3SORA 4B6EA 1HNEE 1O2UA 3LC3A 3ZV8A 4XE4A 4AFZA 1W13U 1YLDA 4VGCB 1Y3WA 1ANBA 1TA6A 3UWJH 1P02A 3TGJE 4H42U 2XWBI 5HIZA 3AAVA 4AN7A 5JBCS 1PPHE 4AOQA 1C5VA 4BAQB 1EASA 3F0OA 3FAOA 3KYFA 3OTJE 3RMOH 1T4UH 3ODDA 2FIRH 3NRLA 4JK6A 1RXPA 1HFDA 2AHME 2JIZD 4X8VH 3M7QA 1W3CA 2XC4A 2QF0A 1TPSA 2P3TB 2OQ5A 1SFIA 3RXPA 4CHAB 4MPXA 4BAOB 3SOSA 4ABJA 3F0PA 1BBRK 2VH6A 3C1KA 3PO1C 3BTGE 1KDQB 3SU5A 2GJGA 5C2ZA 1H8IH 2PWXA 2ZA5A 3CS0A 1WTGH 4R0IA 4H6TA 3SUEA 4NIXA 5SGAE 3D62A 3F9GA 1MTVA 5HYOA 5FBIA 1G30B 1UTJA 4WH6A 2PGQB 4MQAA 3BIVH 4IMZA 3PO1B 2ZIQH 4B71A 1O3LA 1O3MA 5T6DA 3ELAH 1SR5C 4VGCC 1FONA 2QGRA 4FOUC 1TGTA 3UNRA 1BRCE 4Y0ZE 3F9FA 2EQNA 3LIWA 2SFAA 1E34B 1OPHB 1XKAC 1QY6A 3BTFE 1IQIA 1FY8E 1TRYA 4GVUA 5LPFA 1AGJA 1GBJA 2ZPQA 1E1RD 1FJSA 2A4RA 2A32A 2UUKB 4I8GA 4WF8A 4DURA 1J14A 1E1QD 1Q3XA 3RU4E 3FZDA 1TABE 2P93A 3UUZA 2Y5HA 4TY6A 5T6FA 1S84A 3MU4A 5DO4H 4AYYB 1O2MA 4CH2B 2PR3A 1KTTB 2AMQA 2BY6X 4X2VA 1SSXA 3GY3A 1LHEH 3O8DA 1ZPBA 1O5DH 1TONA 1O2PA 1OSSA 1UHBB 1UVTH 5C1XA 1QRXA 4UFDH 2HOBA 2BX3A 2GP9B 1O2IA 2QXJA 2DUCA 1BT7A 2FO9A 3OSYA 1G2MA 1GCDA 3JZ1B 1JXPA 1DSTA 1YPHC 2F3CE 3ITIA 1VITG 2H5DA 4A1XA 3RXFA 1FNIA 3Q3KA 1O3OA 3A7TA 4Z0KA 3OY6U 3SUDA 1P04A 3FANA 1DXPA 1IQNA 3N7DA 1O30A 3W95A 2UUYA 2XC0A 3PB1E 2FTMA 1GHAG 1NRSH 1MD7A 5T1VA 2O8MA 1EKBB 1TPOA 4RN6A 1V2LT 2NU2E 5KGOA 3IG6B 4BNRA 2D1JA 2AERH 1EQ9A 2FDAA 5E2PA 5HXFA 4D9RA 4ZROA 2ZHEH 2IPHA 5CMXH 1Q2WA 1YPEH 1GMHG 4WJG2 5FX6A 3H7TA 1YPLH 4FUJA 1XUKA 1W7XH 3K9XB 6CHAC 1C2HA 2ALVA 3SJIA 1NU9A 2TPIZ 2WINI 5CDFE 1JRSA 4F49A 1F5RA 4B6FA 2Z9KA 3W1EA 1DT2A 3HKJB 4XFQA 2Z6BD 1C5YB 1L0ZA 2A4QA 1BMLA 2ZEBA 1HAHH 1DFPA 1XMNB 2IJD1 1BTWA 2J38A 1DANH 3MOCA 1OXGA 4DG4A 4D76A 2KAIA 3WW7A 4ZH8A 2C90B 1CGJE 1SPJA 1SLVB 1V2KT 2Y7XA 3E3TA 1NC6A 2O8WA 1O3KA 3TIUA 5EXNA 2FWWA 4IN2A 3E91A 3TK5A 1B5GH 1AHTH 4JYTA 1A3EH 3FP6E 3RC4A 3TGIE 1TPPA 2QXIA 3BSQA 4I32A 4OS1A 1YM0A 2ZGBH 3VFEA 3LGWA 2WPDD 2VWOA 4JYVH 1FPHH 1VITH 1GMDF 2BD8A 1J8AA 3TJOA 3URCA 4HTCH 5J4QA 2KCOA 2ZPRA 3K6ZA 3LOXA 1YC0A 2ZF0H 5I46H 1L1NA 2TBSA 2Y7ZA 2WPIS 1Y5UT 2FOHA 3MH6A 4GSOA 2ZFSA 5DJ7A 4XOJA 3DT0H 1SGEE 5E0GA 4F55A 4DW2U 1RRKA 1C5TA 1A5IA 5DK1A 1GI8B 1BTPA 1MAXA 1HDTH 3MU8A 2OK5A 2FOCA 4MNYA 3SZEA 5HGGA 2F83A 1AVGH 1P12E 1HJ8A 2EI6A 2RA0A 2UWOA 4ZKNU 3I78A 5FCRA 3BG4B 2C4FH 1BZXE 1BHXF 1GI0A 4MPUA 4D7GA 3ZZAA 3P17H 3SW2B 3MI4A 2BDCA 1BMAA 1S0QA 3M35A 2VGCC 1DITH 1EP6A 2ZFQH 3UPEA 2G5NA 1LVMA 2ZTZA 1MZDA 1O3AA 2VIOA 2VNTA 4WH8A 2WPMS 3UOPA 1P8VC 2GV6A 2FESH 1TGBA 2F9VA 1ELAA 5J4SA 1C4Y2 1D6RA 1HLTH 5FPTA 2WZQA 3TK6A 2FI5E 4X6MA 1HAXB 4BAKB 4Q4LA 5LPRA 2P8OC 3U8TH 4THNH 5HM9A 3LKWA 3S9AA 1L1GA 1MU8B 2IPQX 1V2PT 1ESBA 3VXEH 2HLCA 3MU1A 4K1SA 2FM2A 5FBEA 1T4VH 5KECA 1V2QT 2QF4A 1ZYOA 1RIWC 4BXWA 5F8TA 4X1RU 2AIPA 2STAE 2FOGA 3P95A 1QB9A 1K2I1 1VJ9U 2NU3E 1ABJH 2G00A 4NA7A 5ABWA 1JBUH 2HVYB 3QO6A 1Y3UA 1S81A 1O2RA 4CRBA 1P01A 2R2WU 3M5LA 1D3QB 1GHAF 4OGYA 2A4OA 3EE0B 1UCYK 2BDIA 4MG3A 2HPQH 4PROA 3LONA 5EXLA 5C94A 2OQUA 1BTYA 2GMTC 3PV5A 1GBAA 1HRTH 1O5CB 1P2IA 1OS8A 2CF9H 4CBNA 4B1TA 1P2NA 1V3XA 3P8NA 4UFEH 2LELA 5EJLA 1E38B 3C27B 1VGCB 1HJAB 4ZKOU 1AU8A 2GCHF 3KHVA 1YPKH 2VJ1A 1GBMA 2Y5GA 1KIGH 1YCPM 1V2OT 1ZTKA 4LZ1H 3PRBA 2Q6GA 1ARCA 3T5FH 3BEUA 1LCYA 4TY7A 4FUEA 3FKSD 1TE0A 1Z1IA 1XKBC 5C17A 4U30A 1QBVH 4X6PA 4AC9A 2FEQH 1C5WB 2ZKSA 3E6PH 1DLKB 1AO5A 3RP2A 1EZXC 2R3YA 1DSUA 1ID5H 2FX6A 3LPRA 2VWNA 3E16B 1CBWC 2OBOA 3STJA 1PQAA 3RC5A 2H2ZA 3GISB 3RXIA 5L30H 2ZGHA 1EAUA 4BANB 1LQDB 1V2RT 3PMJA 2ZU3A 1RD3B 2W3IA 2D2DA 3RXKA 1M9UA 5AF9H 2VWLA 5DP8A 3FN8A 3RXGA 3GDUA 1LQEA 1DWDH 5A0BA 2GZ7A 1C1SA 1SG8B 2GGVB 4X0WU 2ANKH 3CNRA 2ODPA 2A5KA 4U01A 1OWEA 1HPGA 5B6OA 3GCOA 4GAWA 2BYAX 3L6PA 3BG8A 3CP7A 2FI4E 1BMFD 3VGCB 2WPKS 2O8TA 5E8EH 1BTUA 1TMBH 5GWZA 1NO9H 1P9SA 2M5TA 1MMJN 1ZGIA 4ZXYH 1D3TB 5JBAS 4NFEA 1MTWA 1NN6A 3QGNB 1SL3A 1TNHA 2BDHA 3GCTG 3U28C 1EP5A 3MO6A 1UK3A 5C3NA 3GCNA 4ABGA 1SMFE 1G32B 2B8OH 4TT3D 1TGSZ 2BLVA 4MLFB 1C1VH 3MMGA 3MYWA 6GCHG 1ETSH 2ZQ2A 3SJ8A 3RM0H 4ASHA 3KYGA 1Y5AT 4AG2A 1EAXA 2A2XH 1AWHB 3UY9A 3ZZ7A 2BHGA 1CBWB 1L4ZA 4K2YA 3PM3A 3P6ZB 2C8WB 5C67A 2OP9A 1KDQA 3B9FH 1RS0A 1O35A 1K9OE 2AFQB 3UOUA 3SQHE 3LDXH 1SGDE 1VCWA 2GTBA 2P3UB 5FXLA 1CT4E 3LGTA 2VINA 3I77A 1AN1E 1O2SA 4U32A 3ZYEA 1ACBE 2BD7A 4OS4A 3GY6A 2ZDAH 3A81A 4E7RG 2OC7A 1ANCA 2VWMA 1AVWA 3QDZB 1HJAC 1DLEA 2RA3A 3OYPA 4KGAA 3PMAB 1THRH 1U6QA 5E2OA 1HAOH 3ZZDA 1GBIA 1NRPH 5GPIB 1N6XA 1FMGA 1N1LA 3S9CA 4INHA 4WXVA 4DOQA 1TNKA 4K8BA 1C2JA 2P3FH 2PTCE 2LPRA 1DWBH 4FUDA 1ZR0A 3BTEE 2A4GA 2A7JA 5FCKA 1A0LA 5GDSH 1LVOA 1AUTC 2BDYA 4MNXA 4ESTE 4FUCA 4O9VA 5CHAB 3BTTE 3DSGA 1PPZA 2IOTA 1WYKA 3H5CB 3WWFA 2BY9X 4BTIB 4DGJA 3OAAD 4ABHA 5A8ZA 2R3UA 1DX5M 4FUGA 1ELVA 3P70B 1EPTC 4ZHMU 3RXAA 7LPRA 1GJ8B 1QJ7B 3SGBE 1NT1A 2QY0B 1LVBA 5CE1A 3SN8A 5E0HA 1Y59T 1ESTA 1SVPA 2ZU1A 1P2KA 2XWAA 3A83A 1MAYA 4LXBH 3A8DA 2AMPA 3GY8A 4Y76A 1BTZA 3SU6A 1SGQE 2ZWLH 1OWIA 3BTKE 5GJ4B 3NWUA 1GGDC 2FMJA 1QJ6B 1FX0B 3W94A 5EGMA 2CGAA 3MO9A 1OYTH 4MNWA 1QB1A 2G4UA 2Z9JA 3SGQE 2SGPE 1MBQA 1MCTA 5IK2D 1N6YA 4JYUH 4ABBA 1P2QA 4OGXA 3RXHA 5DSFA 3ZVGA 3RXTA 4XSKU 5EU8A 1ELDE 1CGIE 3SV9A 1BOQA 4XBCA 1O3CA 3ZVEA 1Z8IB 3VG8A 1Y3XA 4DY7B 2GDEH 2C8ZB 4QT8C 1HCGA 3OEHD 2VGCB 4Y0YE 4E06H 1GL1A 4Q2KA 1O2HA 2Q6DA 5HMAA 1P0SH 1S6LA 2VIWA 5DP5A 3GY7A 2F91A 3ATLA 1GVLA 2PSXA 3OEED 3EYDA 2CXVA 5H4IB 1S83A 4U2WA 1ZRBA 2FOAA 4NZLA 2ZHDA 1GG6C 1NROH 1C5RA 3P8FA 3RXQA 1CU1A 3M3SA 1F92A 3P8OA 6GCHF 3S7KB 4E05H 1ABIH 1QQ4A 1XX9A 1W11U 3PTNA 8GCHG 3MNXA 1DUEA 5EXMA 2P94A 4XDEA 3AASA 1BJVA 1C5MD 1C9PA 1QBOA 3BN9A 2BY8X 5EIYA 3RLWH 2Z9GA 2L74A 1GDUA 3I29A 4TPIZ 2W3KA 3UAIC 1NBMD 1WOFA 4Q63A 2WPLS 1YLCA 2W7SA 3MH4A 2YMSB 2QC2A 1C5UA 1GJCB 3AW1A 3FO8D 1A7SA 2BOKA 1O2QA 1C2DA 2WV4A 4O97A 3KQBA 2ZCHP 2FX4A 1T8LA 2Y82A 4HFPB 5BPEA 3U8RH 2ZP0H 1HXFH 1W14U 3VB7A 1PQ8A 3KL6A 1HUTH 2AGIX 1EPTA 3RXMA 3TGKE 1NM6A 1A3BH 4I8JA 2H1UA 4CR9A 1GG6B 4A5TS 5C0TA 1HAZB 1DWCH 4X1QU 2EC9H 4H4FA 3K6YA 5FAHA 1K1MA 2OCVB 1GI5A 2VU8E 1KXDA 4X2WA 5F6MA 4CRCA 4M7GA 2GCTB 1C2KA 5DG6A 2FOEA 3BEFB 6CHAB 1AZZA 1GI9B 1V2JT 3SV7A 1KYNA 5AVDA 3UQOA 3GYMA 1WUNH 4ZAEA 1NESE 1H4WA 3SGAE 3SI4H 4D7FA 2BD9A 2QXHA 2HNTE 2PKAA 1SHYA 4JZEH 2H9EH 1LPGB 1SQRA 1FAKH 1NU7B 3DA9B 1AZ8A 4GUXA 4CBOA 3S7HB 3T26A 3PV2A 4J2YB 1GHZA 2KZ4A 3GCHC 5A0CA 1KXCA 1C2FA 4HG6A 1NRQH 4HZHA 4Q7YA 2PGBB 2J34A 3PMBB 3UQVA 2BY5X 1MTSA 1ZLRA 2OLGA 5LGOA 4Q7ZA 2VVUA 4X6NA 2FODA 2AIQA 1AFEH 2G55A 2V7QD 2SGEE 5JB8S 3E90B 3VEQB 3BIUH 1TGNA 3HPTB 1PPCE 4Z6AH 1SGPE 5EJ1A 1XXDA 3TPIZ 1C1UH 1O37A 3KF2A 3UR6A 1GBDA 1TGCA 2GDDA 4I8HA 2Z3CA 1WDIA 3PLPA 4O3TA 2BZAA 3T25A 3BTDE 1O2NA 2EI8A 1PYTC 1TALA 1UJ1A 4OS2A 1QR3E 1Z8JB 2WYGA 3F2FA 1TQ7B 2PFEA 4K60A 3MTYA 2J9NA 3MWIU 1P2JA 3F2HA 1CHOF 2A5AA 5CHAC 1T7CA 1BBRH 3MNBA 2PKAB 1QIXB 2AS9A 1ZHRA 1LHFH 1GCTC 1UVUH 3A88A 4DJZB 1H8ED 3ZVCA 3KIDU 1LHCH 3DFLA 3GS9A 5C0UA 1EZSC 3O8BA 1WQVH 1YPJH 3OX7U 1ANEA 2JJ1D 3SV2H 3OTPA 4WXIA 1LMWB 2XBVA 1T32A 2WHXA 1SGFA 1O5FH 2UWLA 1C9TA 4DIIH 4JZDH 3L33A 1C1WH 2F4LA 3A8CA 2GZ8A 1GJ6A 2JJ2D 6ESTA 1L1JA 2GVFA 1GJ9B 5FPYA 2NU1E 4AFSA 1IHSH 1H8HD 1THSH 3R0FA 3N99A 2WSSD 1OWJA 2BLWA 2JH6D 4XRNA 1C5XB 1UTPA 3E0PB 1HYLA 4BXSA 5DP9A 1C1TA 3ATKA 1G37A 3Q3XA 5EW1H 4MPWA 1EXFA 3T2NA 1V2MT 2UWPA 3DFJA 4O03A 1G2LA 2Z94A 3A8BA 2BTCE 2ZECA 1A0HB 2CMYA 2K8IA 1NPMA 1KTSB 4J1YA 2J98B 4O3UA 3TH2H 2ZDLA 1EATA 1DE7H 1LKAA 3SNDA 1TBZH 1ARBA 3TK9A 4X1PU 1TX6A 2ZU4A
chains in the Genus database with same CATH topology
2OXSA 4Y11E 4ISHH 4IBLH 2W5EA 2B7DH 1CGHA 1QRZA 1O39A 1CT2E 4SGBE 2LNCA 1S82A 1GDQA 5GIBA 4YESB 3RXCA 1VJAU 2HNTC 4YT7H 1BDAA 1ZMLA 2QIQA 1ZJKA 3QZQA 3LC5A 2PLXA 4GCHF 1QFKH 1TNLA 5L2YH 2GCHG 3PYHA 1CA8B 5FHTA 1WV7H 1BB0B 2XRCA 3LGYA 4WY3A 3CENA 4X2XA 1MTNC 3TJUA 1BJUA 1E35B 2GT7A 1W12U 2Q6FA 3TVJB 3ZZ3A 1YPGH 4LOYH 4IMQA 3M3VA 2BDBA 3WY8A 1OOKB 2ASUB 3GYLB 3SBKA 1SC8U 1YPHE 2WUCA 4IC6A 1HAIH 1KLTA 1GJ7B 4YM9A 1A61H 1MCVA 3TITA 2K1QA 1NZQH 1ZPZA 2HGTH 3EA8A 2ZFRH 1JOUB 1KXFA 3BTWE 3QGJA 8GCHF 3EQ0H 3GCTF 2PSYA 4KELA 4LK4A 1ETTH 2CF8H 1O2XA 1OWDA 3T28A 2AH4X 1GHXH 2QN5T 2TIOA 3F6UH 2P59A 5TCAA 1EB2A 1K1PA 3V13A 1VGCC 1A4WH 1TAWA 4AX9H 1HAGE 2VIDA 5EQSA 4AG1A 1ZTLA 1D6WA 2ZFPH 1TA2A 4KTUA 4CRAA 1V6DA 4XBDA 1ZOMA 3V7TA 4X1SU 3QWCH 4ISNA 4CRDA 1CA0B 1O2WA 1JRTA 4XBBA 5A09A 4K5ZA 2GZ9A 1L2EA 1CE5A 2PKSB 4JZ1A 1S6FA 3T29A 4KP0A 1P3CA 1TOMH 5BRRE 2ZDNA 2C8XB 1F2SE 1O3GA 1RTKA 3FVFB 5F03A 3SV6A 4NA9H 3LH1A 3Q3YA 4X8TH 1KLJH 2THFB 1OWHA 2F9OA 2SNVA 2F9NA 3A7WA 3SJ9A 3EA9A 2V3HH 1O2TA 2R0LA 1JMOH 2JH0D 1RIWB 3RXBA 1GI1A 1GPZA 3ZZ4A 1GI3A 1ELEE 1T8MA 2Q1JA 4FUHA 4AFUA 4MNVA 1EOLA 1AE5A 1H9HE 1GBEA 4RSPA 2OD3B 4WMFA 2RCEA 2J94A 3TH4H 1FN8A 2P8OB 3SNBA 5IYTA 5DP3A 3MNCA 1TBQH 2ZC9H 3L3TA 1BIOA 3GDSA 2O9QA 1W0ZU 1C4V2 1F5LA 1HIAA 2QYIA 3Q76A 2SGAA 3P92A 1QHRB 1GGDB 3ZVFA 2CV3A 3UFAA 4CH8B 1NTPA 1TMTH 2FLRH 1CHOG 2ZGJA 3D49H 1TBRH 1ETRH 1C5LH 4F4OC 1BRAA 1SGRE 1LKBA 1O38A 1LDTT 2PTNA 1OX1A 4ZHAA 3VXFH 1A0JA 3GY2A 1QL8A 2BQWB 2I6SA 1HAPH 3BG4C 4KKDA 1NRRH 1C1QA 2FS8A 4Y7BA 1AMHA 1UTLM 2BXUH 1PQ5A 4A6LA 2ZO3H 2FYQA 1CHGA 3UR9A 2Z9LA 1V2ST 3RMNH 3RXLA 5JB9S 5IDKA 3R3GB 1QL9A 1DDJA 2Y6TA 1AD8H 2QCYA 4NFFA 2FPZA 2FOMB 1HJ9A 3Q00A 2XW9A 3ESTA 1CA0C 1F7ZA 1ZTJA 5C1YA 3HK3B 2ZHFH 4HGCA 4NG9H 1K1OA 1SGIB 3MH5A 4I33A 7GCHF 1DPOA 3TU7H 1IHTH 1TNJA 2A7CA 2C8YB 1KXAA 2PW8H 1K28D 2CHAC 1MD8A 2ZHQH 2ZGCA 1GJ5H 1TYNA 2BDAA 1O3PB 3RUOA 4FVBA 7GCHG 3K2UA 4H6SB 1OKXA 2WV5A 5A8YA 3PLBA 3HGNA 2ODQA 3KQDA 1A5HA 1EZUC 5JYIA 1WSSH 1Y5BT 2BZ6H 1SGCA 1F0UA 2FOBA 1WCZA 1PYTD 2V6NA 2BDGA 4JZFH 1WQSA 1XUJA 3IITA 1J9CH 1AE8H 4DVAU 4IC5A 1UTKA 2ANWA 1B7XB 1SQTA 4AZ2B 5C1UA 1BCUH 1UCYE 2XC5A 3BTQE 1YGCH 1E36B 1OP2A 4UE7H 2H9TH 1EOJA 3M37A 3SU2A 2BMGB 1ZMNA 3TJVA 5F8XA 4YOIA 1DWEH 1SI5H 4NIVA 4E7NA 2VVCA 1GDNA 4YOGA 3SQEE 4CR5A 1MBMA 1XUFA 1GVKB 1GBFA 3SV8A 1W2KH 4WVPE 4BOHA 1RFNA 3FZZA 1W7GH 1Z1JA 2FP7B 4AGKA 2GV7A 1UK4A 3KEEA 3DHKH 3SNEA 2ZHWH 1SBWA 1RJXB 3PTBA 1A46H 1EJMA 4BTUB 4MTBA 5G4BA 5GXPA 1MKXK 1G3DA 1FXYA 1GI2A 7ESTE 1D3DB 1WU1A 1YPMH 2A5IA 2BXTH 1P10A 3MU0A 1GMCG 5EPNA 1OYQA 1Z6JH 2YNBA 5TJXA 3V0XA 4AFQA 3A87A 3SHCH 1K1JA 1C1RA 2XBXA 3M5NA 1N8OB 4R8TB 3K65B 2H9HA 2G8TA 1KY9A 2IN2A 1BHXB 4D8NA 1QA7A 8LPRA 3U69H 2ALPA 2ZFFH 2WYJA 1SGNE 3GOVB 5L6NH 2H5CA 4A7IB 2PV9B 4I8KA 5FPSA 1NFWA 2JETC 3ATMA 2ZNKH 2BQ7B 2NU0E 2JKHA 2OTVA 1AUJA 1ZSKA 3UIRA 3UTUH 1GBLA 3F9HA 1FY5A 1K22H 1SLUB 2OC1A 4AB9A 4HI3A 3SJOA 1UK2A 3ENSB 3PWBA 1CVWH 5EG4A 3KGPA 4Y10E 2GD4B 5JBBS 2BVXH 2P95A 1THPB 1UVSH 1SGTA 1PPBH 1FLEE 4ABDA 1QA0A 1UVOA 2F9PA 4GPGA 3O8CA 3D23A 3ZZBA 3QLPH 3CS7A 3O8RA 4CHAC 1AIXH 2C3SA 1A1RA 2FTLE 4KTSA 3V12A 3ATIA 2D8WA 1ZHPA 1O34A 1W10U 3UWIA 1MUEB 1GBHA 3HKIB 2XCNA 2Y5FA 3KNXA 1FPCH 1VCQA 4NZQA 3OY5U 3S69A 1RTFB 9ESTA 5DP4A 5AFYH 1C2GA 4YOJA 1BTXA 1MKWK 5ETXA 3LH3A 4GLYA 1V2UT 2Z7FE 4WMDA 4GHQA 1BMNH 4MDSA 2WPHS 3RM2H 1FY1A 1UMAH 1F5KU 2WUBA 2YOLA 4Y7AA 3MH7A 4B2AA 1C1OA 1QCPA 3ATWA 1UO6A 5C20A 1QURH 1PPFE 2B5TB 5FX5A 4LZ4B 1XM1A 3GCHB 1J15A 1H1BA 2R9PA 3RXUA 1DY9A 3E0NB 1Y8TA 3G01A 1C1PA 1HIAB 1BUIA 2Y81A 1Z7KA 1SQAA 3QX5H 2EEKA 2AYWA 3LU9B 1IAUA 1O5BB 3QN7A 1K21H 5EOKA 4FU9A 4NWKA 1HBTH 5GCHG 1KXEA 3ZVBA 3B8JA 4A92A 1LPZB 1AQ7A 2YNAA 1ELTA 1G36A 2V0BA 2KAIB 1P57B 1O2JA 1P3EA 1ZRKA 2EA3A 4JMYA 2ZCLP 4DCDA 1EJAA 2GT8A 5EW2H 1FY4A 2XXLA 1AI8H 1FIZA 3RXSA 1GJBB 3SU0A 2FZZA 3KQCA 1AFQC 1Y3VA 2BLOA 3KN2A 1XUIA 1PPEE 1QNJA 2BX4A 1TB6H 1O36A 2G81E 4KTCA 3A7ZA 4Q7XA 3LGUA 1DVAH 4ISOA 5K7RA 2BD2A 4ABIA 1H9LB 1V2NT 2EI7A 2TGPZ 3SU4A 4TWWA 3NPSA 5DGJA 1SFQB 4AORA 1G3BA 2QF3A 3NCLA 8ESTE 1UCYH 3F9EA 1TIOA 1C5QA 4ISIH 3RXOA 4YZUA 2F9UA 2H6MA 3SZNA 5C5OA 1TFXA 2TGDA 1S5SA 1V2WT 4FU8A 4B2BA 4GCHG 1ELBA 4Y6DA 1CO7E 1G9IE 1PQ7A 2GX4A 4YT6H 1AKSA 1UTMA 5ESBA 3RXRA 1IQGA 1GMCF 1B0EA 4RKJB 4B75A 1DY8A 2A31A 2J4IA 1IQJA 1BRBE 2CHAB 3GICB 4YLQH 1AB9C 1BQYA 4Y8XA 3UNSA 3STIA 2B0FA 2BVSH 2ZZUH 5JPMH 2A0QB 1TQ0B 2A7HA 3P8GA 2XTTB 1C2EA 3M61U 1O5EH 2ULLA 2HALA 4OS5A 3M36A 3SJKA 5L2ZH 3HATH 2OC0A 3TJNA 2Z3DA 2VVVA 1Q31A 1H8DH 4MPVA 3RXEA 1C1NA 3LJOA 3IWMA 2VIVA 5E0JA 1DS2E 3ZYDA 2XNIA 1O3HA 1JWTA 3A7VA 3RU4T 3VB3A 3NUMA 1C5OH 1ZGVA 2AGEX 3LGVA 2R2MB 1GJ4H 3Q77A 2BB4A 1RTLA 1O33A 1NS3A 1ZZZA 1FY3A 3A85A 1GI4A 2OBQA 3JZ2B 1C1MA 4K3JA 4I7YH 2ZTYA 1V2VT 3NZIA 1UVPA 2ANYA 2RG3A 1JIRA 4B74A 4B73A 3LT3A 4UONA 1ZSLA 3T27A 1RGQA 2B9LA 3RMMH 3URDA 3A89A 2STBE 3FFGA 4CRGA 1O32A 5TCCA 4MVNA 4ZMAH 1QL7A 1HAVB 3M5MA 2ZGXH 2FI3E 2Y80A 3VB6A 4AYVB 2HNTF 1IQHA 4ZHLU 2ANMH 2A2QH 3AAUA 1F0TA 3S0NA 4I31A 3SU1A 3PV4A 2TGTA 6LPRA 1K1LA 3A7YA 4Q80A 4JK5A 2AMDA 1E37B 1SOZA 1K1IA 2R0KA 4UDWH 1TOCB 1P03A 1O3NA 2ZDMA 2HRVA 1E0FD 1QJ1B 4IGDA 1QBNA 1QRWA 1ZHMA 3A7XA 3PMHB 3DD2H 2G51A 1DXWA 3SNAA 1V2TT 1SB1H 1WAYB 2QAAA 4K8YA 1FAXA 2ZG0H 2RDLA 1BA8B 1L4DA 1C4U2 4WMEA 1GBKA 4X2YA 4NSYA 1GMHF 2J2UA 2QA9E 2UUFB 2ZU2A 3M7TA 1O3BA 4NA8A 1O2GH 1TRMA 5DP7A 3MO3A 1IOEA 3AW0A 1DOJA 2ILNA 3U9AH 1HXEH 2XCFA 4YTAA 1HV7A 4IS5A 2FXRA 1X7AC 4X6OA 1S0RA 1AWFH 1OWKA 3EGKH 1BTHH 3OU0A 3ZZ6A 1SGYE 4Y8YA 1ELGA 4TYDA 3VPKA 4ISLA 3MFJA 3U8OH 4K1EA 5LPEA 1QB6A 2JETB 3TLOA 1FIWA 5T3HA 4FUIA 2A1DB 1P09A 3UREA 4BTTB 3BTHE 4RKOB 1O2VA 5A0AE 1DICA 1NFXA 1XXFA 4ZXXH 1T8NA 2G52A 2ZCKP 3EAJA 1C5PA 3ZZ8A 5I25A 1O3EA 2ZTXA 1N8OC 4FVDA 5AHGH 1Y3YA 1K1NA 5F8ZA 3MHWU 5EODA 1NRNH 1OP8A 3VGCC 3SU3A 1KSNA 1MTUA 1ZPCA 1LVYA 2SGQE 2AGGX 1Z8GA 5T6GA 3RXDA 1O5AB 2VIPA 1O3FA 1BITA 3QK1A 1EAIA 4AGJA 1D9IA 3EA7A 1GBCA 2QXGA 1IQEA 2ZFTA 2SNWA 2JH5D 1MH0A 1XVOA 5A8XA 2VH0A 2ESTE 3RLYH 3TNTA 2OUAA 3TNSA 4FUFA 1P11E 1H9IE 1GBTA 2ZDVH 3A86A 1J16A 1P06A 3S9BA 2C93B 1NFYA 1C2LA 2UUJB 1TLDA 2G5VA 2BY7X 3EDXB 1ZMJA 1FQ3A 1UHBA 3GY4A 3T62A 4B2CA 1O31A 1P05A 1F0RA 5DPAA 3RMLH 1O0DH 2SGFE 2PHBA 2O8LA 3NXPA 5HM2A 1UTQA 1Z71A 2G4TA 4ABAA 3RXJA 2VIQA 3A80A 3ZVDA 4CRFA 1EB1H 1GI6A 2BD4A 1A2CH 3FP7E 2ZI2H 4Y71A 3DUXH 3LJJA 3HGPA 2J92A 3QZRA 4YLUA 5ESTE 4TPYA 2ZU5A 1C2MA 1IQLA 1ELCA 3TH3H 1VITF 2BD5A 2FLBH 2SGDE 1FN6A 2P16A 2CJIA 1S85A 3MNSA 3N7OA 3UNQA 1W8BH 1XUHA 4DIHH 4INLA 1VZQH 5JDUB 1EZQA 2ZQ1A 2BLQA 1MQ6A 1GL0E 1NFUA 1XVMA 1NY22 1O3JA 3E1XB 1GCTB 3NK8A 1UTNA 1HAYB 3B23B 5C5NA 1LO6A 7KMEH 3ZV9A 2V35A 1EAWA 1B0FA 4CREA 3U98H 2NWNA 1QTFA 3U1JB 4GHTA 1UTOA 2PUXB 3RXVA 2GMTB 3ZZ5A 1LPKB 1C2IA 1S6HA 1O2LA 3A8AA 1JIMA 3SUFA 1QQUA 4X8SH 1LHGH 3H7OA 1G3EA 1HB0B 4WWYA 5EQQA 2BQ6B 4B76A 1SQOA 4D9QA 4UD9H 3QTVH 1TNGA 2BM2A 2HVXA 5LH8A 1P2OA 1WBGB 1VR1H 2A45B 1GHBF 1C5SA 1KXBA 1YYY1 1O3IA 2DE8A 2BOHB 3SNCA 1YF4A 4ZKSU 3RDZA 4ZKRU 1GHBG 1GBBA 4DT7B 5PTPA 2W7UA 4SGAE 1SLWB 1GVZA 1P2MA 3U1IB 2HWLB 1EX3A 1W0YH 2OINA 2BVRH 2FOFA 5DKMA 4INKA 2J95A 4Y8ZA 1GHWH 1ANDA 4OS7A 1DM4B 1GJDB 1GHYH 1LHDH 1PFXC 4X1NU 1O2ZA 1PPGE 1MKWH 4YO9A 3PWCA 1ORFA 3KQEA 2GCTC 2XBWA 2PKSC 1FV9A 1CQQA 5K0HA 1SHHB 1D3PB 3RC6A 1FI8A 3VB5A 1C5ZB 1IQFA 3M5OA 1J17T 3BTME 1AB9B 1O3DA 4NCYA 3BV9B 1BBRE 3MU5A 1O2YA 1AKSB 1EUFA 1TPAE 2Z3EA 4I8LA 3SHAH 2O8UA 1IQKA 3HK6B 4FU7A 1AY6H 2CN0H 2Z9IA 1F0SA 3F68H 1AVXA 5GCHF 1ELFA 3BEIB 3V3MA 2PUQH 3KCGH 1SGFG 3GY5A 4JZIA 5AFZH 1KLIH 3AVZA 4UFFH 8KME2 1BRUP 4UEHH 2IJOB 4ABEA 1TNIA 1T8OA 4K1TA 2GKVE 4K69A 1SOTA 4A1VA 4NGAH 1DUAA 1GI7B 4BAHB 4FUBA 3RU4D 2FS9A 3M3TA 1AFQB 1HGTH 1ZSJA 1GHVH 2QV1A 1VCPA 2V3OH 3E8LA 1P9UA 5EQRA 3NKKA 1YKTA 3D65E 4IN1A 1GMDG 4OS6A 2HPPH 2I6QA 2XYAA 3PLKA 1PJPA 2W26A 3A84A 3QUMP 3SI3H