1A0LA

Human beta-tryptase: a ring-like tetramer with active sites facing a central pore
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
244
structure length
244
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPTASE
publication title Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 244
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 1997-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a0lA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1a0lA01
1GCDA 3SJ8A 2GMTB 1IQHA 2VWMA 4MPXA 2DUCA 1NRNH 1C4V2 1TBQH 2FMJA 4WJG2 2W5EA 1O0DH 1BITA 1F7ZA 4X2VA 1T31A 1GBKA 1P10A 2H5DA 1FY8E 3GDVA 1XUHA 1K1MA 1O2ZA 1FIZA 2CHAB 2J34A 1AVXA 1SGNE 4BAQB 1YPHE 3RXLA 1AFEH 2G4UA 4YT6H 1W0ZU 4NA8A 3WY8A 1A0LA 4KP0A 4A92A 1QRWA 5FX5A 1MUEB 1UK4A 2OCVB 1V2KT 2CHAC 1QURH 3DFLA 5AVDA 1O3GA 2ZNKH 2ZZUH 3SNBA 1O3KA 2P94A 1BOQA 1HAXB 2O9QA 4XOJA 2FDAA 2R2WU 1XUIA 3BTDE 3ATWA 1TGSZ 4I7YH 2Y80A 1QB9A 2ZC9H 3FP6E 3BIVH 3TJOA 2HLCA 2GZ8A 1O2WA 2B7DH 1CHOG 2J95A 3MMGA 3GDSA 2AGIX 1BMLA 3GCNA 3M5LA 4NSYA 3GYMA 2BDCA 2CF9H 3VPKA 4J1YA 1J17T 1ELCA 1O3OA 2TPIZ 3MI4A 5ESBA 3SV7A 2Y6TA 2A31A 2J92A 1O5FH 3DA9B 3SOSA 1Q3XA 3OTJE 3RXVA 1FY5A 1P3EA 3SO3A 1XM1A 1C1PA 1DE7H 1EPTB 1PYTD 2ZDLA 4ZUHA 3OY6U 1QL8A 4A1XA 4AFSA 4UONA 1C5QA 1ETRH 1H9IE 1QY6A 2G5NA 2XYAA 4K3JA 4AFQA 1LPKB 1J8AA 4CHAC 3HK6B 3RM0H 3TU7H 1FJSA 1W14U 5A8YA 4ZKRU 1RJXB 3B23B 1HIAA 1EPTC 1V2UT 4IMQA 1HAPH 1C5SA 2OBQA 3A8BA 1V2MT 2JKHA 2WPJS 1XKBC 1V2NT 2JH6D 2FLRH 2G5VA 3NK8A 3KEEA 2GP9B 4FUJA 1DICA 1BMMH 4JK6A 4JZFH 1CT4E 4ABEA 1EATA 1WTGH 3BTEE 1TPSA 3P6ZB 1FN6A 4TPIZ 3QLPH 1KLIH 2A7JA 5HYOA 5A09A 1FPHH 1O3FA 1ZRKA 3U98H 1ANEA 1BTHH 1UHBA 4K8YA 2XC5A 3MU5A 3M3SA 3DD2H 1TFXA 1NFUA 4DGJA 3RXCA 3E91A 3BTTE 2PV9B 3QDZB 5GDSH 1NM6A 1VR1H 3QUMP 5CE1A 1Z1IA 4K1SA 4GLYA 1AVWA 2EEKA 7GCHF 2V35A 3D62A 1SGFG 3PMJA 2ZF0H 3A83A 2ZHEH 3E1XB 5T6DA 4FUDA 3LGVA 4MLFB 3LC3A 1YM0A 1SOZA 1UCYE 2ANYA 3QK1A 3ATMA 3MU4A 1ZLRA 1MKXK 4OGXA 1YPHC 3TNTA 1TIOA 1GI4A 2OBOA 3ZZ3A 5J4QA 1AU8A 3GY2A 4HGCA 1G3BA 3KNXA 1TNLA 4X8VH 1DDJA 1MTVA 2SGEE 2GZ9A 1TOCB 1HAHH 2BD4A 4JYUH 2VWNA 1HAVA 1S0RA 2VWLA 1O5CB 1DY8A 2Z9KA 4Q7YA 2H5CA 1FAXA 2FESH 3RXKA 4AB9A 2QXIA 2D1JA 3A82A 3GCTG 1B5GH 3RU4D 1O2RA 1TMTH 3STIA 1HIAB 2Z94A 3VB6A 1GBHA 1FI8A 2ZPSA 1HJ8A 3VB3A 2EC9H 2WPIS 2FOCA 2SGFE 4CRCA 2SGDE 3HKIB 3D49H 1W13U 2ZU4A 4DOQA 2TIOA 5A0BA 5BRRE 2FOEA 2TRMA 4MNWA 2FWWA 3GICB 3LONA 4I8LA 2YOLA 3LOXA 1GI9B 1AO5A 2ZFSA 1IQKA 4D76A 1E38B 1K1JA 1Y3XA 1UHBB 4ISOA 4WH6A 1T4VH 1BMNH 2BXTH 2ZPQA 3SORA 3MOCA 3ZZBA 1IQFA 2NU4E 1NRSH 1UMAH 1WU1A 4TY6A 2GV7A 1SGEE 2Y5FA 1UVPA 1GMCG 2GV6A 3UNRA 4AOQA 3P92A 2GT7A 1A7SA 1XVOA 1LHFH 1X7AC 1GCTB 2PWXA 4K1EA 3MH5A 2O8WA 1D4PB 3SGAE 3ZYEA 2PFEA 1P2JA 2C8WB 3I29A 1VCPA 3A7WA 2EA3A 1GCTC 5DK1A 4OGYA 1HAVB 2ZCLP 1OWHA 4LZ4B 5C2ZA 2DE8A 2A5AA 3Q77A 1F5RA 2AMPA 2PKAA 1P2KA 4AFZA 4OS6A 2QF0A 2AYWA 3ZVEA 3EA7A 1FQ3A 3GOVB 4MNXA 1L0ZA 1DPOA 1U6QA 3RMNH 8GCHF 1UCYH 4K8BA 1AZ8A 2XBVA 1SGPE 1THPB 3G01A 1KDQA 3SJOA 2OQ5A 2XTTB 3SV8A 1S5SA 2C8YB 3HATH 1QJ7B 2BY7X 4D7GA 1UVOA 1ZPZA 4MTBA 1LKAA 1C2MA 2D8WA 3KGPA 3A8DA 2OD3B 1NC6A 1MAYA 1P03A 1RFNA 1VJ9U 1PQ7A 3RU4T 1N1LA 4KELA 2ZHFH 2UUKB 3QGNB 2A4GA 2UUYA 3O8RA 1YPJH 1F0UA 1AMHA 1C2LA 1T32A 5DKMA 1FV9A 4YESB 1GI7B 4YOIA 1C2KA 3LJOA 3MNXA 4RKJB 1HCGA 2ZDNA 1JWTA 2J9NA 3K2UA 1BJVA 1XX9A 2J94A 1TGNA 1O5AB 4MNVA 1TNJA 3OU0A 3A7ZA 1S84A 4H42U 2PGQB 2Z9LA 3S0NA 2BLWA 1IQEA 1NRPH 2PKAB 1C5LH 2FX6A 4ZKOU 5GPIB 1JRSA 3S69A 1ZMJA 4CR9A 3S9CA 1ZOMA 5DP5A 3UUZA 1ORFA 1IQIA 1UTQA 3TJVA 4NCYA 3LDXH 1GBAA 3M61U 4Z6AH 3MNCA 3M3VA 4Y8YA 2FOMB 4DJZB 1P2OA 3MO6A 1A0JA 5EU8A 4IC6A 5L6NH 3BTQE 2CN0H 1KDQB 1SGYE 1SLWB 1RD3B 2PR3A 3E0PB 4FUGA 1GBBA 2H9HA 4A1VA 5DO4H 5JBBS 5A8ZA 2ODYB 1LQDB 1TRNA 2HALA 1EB2A 1NRRH 4X6MA 3TNSA 1MTSA 1SC8U 3PM3A 5E0JA 1TGCA 3TLOA 1ELFA 3QO6A 3EAJA 1KLTA 4YZUA 3RLWH 1MMJN 3RC6A 2ZHQH 4MG3A 1K1LA 2R2MB 2FYRA 1MBQA 3GY6A 1O5DH 1ZYOA 5JPMH 1C1VH 1GBIA 1PPHE 4TY7A 3HK3B 1PPGE 6GCHF 2ZG0H 1GMDG 2F83A 4O03A 3SUFA 3RXRA 2BLOA 4Y8XA 1BBRE 1YPEH 2CF8H 1GBEA 4JYVH 4TPYA 3ZVFA 1DWBH 2QGRA 1YLDA 5C5NA 4VGCB 2O8TA 1WOFA 4NZLA 3A7XA 1H9HE 4X1PU 2CJIA 2VVUA 4D8NA 4ABIA 2BD2A 2ZFFH 1ZSKA 4Y10E 1P2IA 1V2QT 4GHQA 3SI4H 3SNAA 1EZXC 1JRTA 1OP8A 4WH8A 5GCHF 1Q31A 3NKKA 5A0AE 3K9XB 2QIQA 4AX9H 5E2OA 5E8EH 3UNQA 3Q00A 1TNKA 3FFGA 3RXAA 2BZAA 3RXUA 2AERH 4IC5A 1TX8A 1A5GH 4AN7A 2F9BH 4XDEA 1O37A 3PMBB 2FI3E 5C1YA 2ZU2A 3ZV8A 2F9UA 4AFUA 1EJMA 1IAUA 2OC1A 1H8DH 2ZPRA 4ABDA 2Y82A 1D6WA 5F8ZA 1C4Y2 1C1OA 2D26C 2PSXA 2FS9A 1ETSH 1F5KU 4AYYB 1HXEH 1QNJA 1SGDE 5AHGH 4AG1A 5LH8A 3A80A 1C5RA 4UFFH 2ZGJA 1Q2WA 5HM2A 4HFPB 4CRDA 2XCFA 3OY5U 3ZVDA 2G55A 3ATKA 2FI5E 1YCPM 2BLQA 3Q76A 1N8OC 2WV4A 2P3UB 1LHEH 3SHAH 2XCNA 4CRFA 2ZECA 2STBE 4UFEH 2A7HA 2VIDA 4DY7B 3UQVA 2BHGA 5EQRA 1CHOF 1Z6EA 5DP4A 1YCPH 3UNSA 4D7FA 1QRZA 1GI1A 1LDTT 1A2CH 3MNBA 6LPRA 5FBEA 3A7YA 4U32A 1G9IE 1JBUH 1QQUA 1DXWA 2VVVA 1ELEE 1A46H 1LVYA 3DFJA 3SJ9A 2G51A 1AE5A 2AMQA 2BY6X 1MD7A 3NCLA 4NGAH 2ZGCA 1FONA 3UY9A 3M7UA 1GHAG 1BBRH 1GJCB 1XUJA 1V2LT 3SHCH 1Y5AT 4YT7H 2KAIA 4F4OC 4Y7AA 1YPKH 5EODA 3LJJA 5DP3A 3H7TA 5FAHA 1DFPA 3GYLB 3TITA 2QCYA 1FNIA 2FS8A 2OTVA 1DWCH 2LNCA 1C1TA 1TGTA 3P8NA 3BEUA 3UR6A 3SGBE 3HPTB 3V0XA 1DUAA 1TWXB 1P06A 5E0GA 1AB9C 4GAWA 3GY8A 1OOKB 1GDUA 3C1KA 1CVWH 1EXFA 1GBCA 4ZROA 3VXEH 1T8NA 2STAE 1PPFE 3MU0A 4B76A 4IBLH 4XE4A 1E35B 2ZCKP 2GVFA 4NSVA 1C2HA 1CBWB 1SI5H 1SLXB 2EI8A 2IOTA 2K1QA 1UVTH 2LPRA 3ZV9A 1O2NA 4NIVA 3HGPA 2SGQE 4ZMAH 2ZFQH 1O30A 3R0FA 3E90B 1CBWC 1D6RA 3KIDU 1G36A 4SGAE 1CT0E 2ZTZA 1G2MA 5FXLA 1C2IA 1CA0B 1UTJA 3NWUA 1ZMNA 1SVPA 4ISHH 3ODFA 4KTUA 1DUEA 3RXBA 3RLYH 3OX7U 1H9LB 3W95A 1LMWB 3K6ZA 1Y3YA 1SOTA 1A3BH 1A1RA 2Z3CA 2FM2A 1CA0C 1Y8TA 3GCTF 4INKA 1B7XB 1LO6A 3PROA 2FOAA 1CGIE 4DG4A 3LGYA 1N6YA 1V2RT 4ABGA 3SV6A 1E0FD 2FP7B 1JIRA 1OWEA 1FY4A 3MTYA 2ZKSA 1HYLA 1MCVA 3MU8A 2Z9JA 2HRVA 2Y81A 3NZIA 3P95A 4KTSA 1KXEA 1AQ7A 2EI7A 3MWIU 2QV1A 3T29A 2ODPA 1K2I1 3HGNA 2FI4E 1ID5H 4MPUA 1QRXA 2YNBA 1P2MA 2GCHG 1GJ5H 2SFAA 2XXLA 3A7TA 3SUEA 1N6XA 2WPLS 3LH3A 1O35A 2Q6FA 1SQOA 4HTCH 3PTBA 4WMEA 1S82A 2BVRH 1O2MA 1P11E 1Y3VA 2A4OA 1GMCF 1TNHA 3JZ2B 1IQLA 3C27B 1O3AA 3VFEA 5DP6A 4BTUB 2OINA 1YLCA 3Q3YA 1MD8A 1O3HA 1O3DA 3PMAB 1DVAH 4BAHB 1ANCA 4CHAB 1S6FA 1W12U 1D9IA 4X0WU 1UCYK 1HPGA 2ESTE 2A4QA 1J16A 4X2YA 1DY9A 1OYTH 1GI3A 5E2PA 2ZFTA 2CXVA 1GL0E 4LXBH 3VGCC 1NESE 2XW9A 1QBNA 3AASA 2I6SA 1XUKA 1W3CA 3UWIA 5I46H 5DP9A 1EZUC 1ELAA 1EAIA 1SHHB 2G8TA 3M36A 1KXBA 4GVUA 2BOHB 3Q3KA 4Y71A 2OXSA 1W10U 1KLJH 2H9EH 4WWYA 5F8XA 1GHWH 5A8XA 2QAAA 4PROA 4ZHMU 3VB5A 1TA2A 2JETC 4A5TS 2PHBA 3M37A 4ZXXH 1KYNA 2ZU3A 1ZSLA 4B71A 1QFKH 3FP8E 3MH6A 4X6OA 5J4SA 3LIWA 4NZQA 4U2WA 2FYQA 4DVAU 1OKXA 2W26A 4ABBA 1O3JA 2OLGA 2W3IA 1EUFA 1O34A 4AG2A 1HAZB 1O2GH 2UWLA 3T62A 3GDUA 2VH0A 4BAMB 1ARCA 4UFGH 4K1TA 1AWHB 1BCUH 1CT2E 2H6MA 1GVLA 4GCHG 2P16A 1FY3A 3P8GA 2I6QA 1SQTA 2ZGXH 4BAKB 5AF9H 1QJ6B 1ESTA 1K21H 5PTPA 1TA6A 1GHYH 1NTPA 3BSQA 1G30B 1O5BB 3BF6H 3SBKA 4ZKNU 3LGTA 4OS7A 3A84A 3O8DA 1S81A 4B73A 2Z7FE 1A0HB 1TQ0B 4JZ1A 1W11U 4UD9H 1SHYA 2QXJA 1W7XH 1O2VA 1TAWA 3RXQA 3SUGA 1GHBG 1F0RA 4FU9A 1NRQH 1O31A 1CO7E 4MDSA 1INCA 2A45B 3BN9A 1K1OA 5TCAA 1O3NA 3ZZ7A 1ZHPA 2UUFB 2XRCA 1RTFB 4K69A 2CMYA 2YNAA 1SGRE 2ZO3H 4BNRA 2DE9A 3GCHB 3QZRA 4O3TA 4YTAA 1CHGA 1EAWA 3LGUA 1JIMA 1ANDA 1BDAA 3FAOA 3W94A 4ISNA 1LHCH 5EQQA 2XBXA 2V0BA 4JYTA 3GCHC 3CP7A 2A5IA 2VNTA 1TX6A 3JZ1B 4GUXA 5K7RA 1ZGVA 1O2IA 1P8VC 2BTCE 1BTUA 4ZHLU 1WQVH 3UWJH 1TQ7B 2WPHS 1EKBB 1O2HA 4Q7XA 5GXPA 1BRAA 9ESTA 4HI3A 1A4WH 3RDZA 1DOJA 1GMDF 2PW8H 1TYNA 1GJ8B 1O2OA 1NFYA 3H7OA 2BD9A 1C2EA 4WY3A 3RXTA 1XMNB 2ZDKA 2BYAX 2RG3A 5GWZA 3FVFB 3SNEA 2ZWLH 7LPRA 2GDEH 3V12A 4X6NA 1HGTH 1MQ5A 2F9VA 1QCPA 1O3IA 1P12E 4FUEA 1UTMA 4E05H 1TABE 4OS5A 5A0CA 4Y0YE 1HAYB 2PLXA 1AE8H 3RU4E 1C5ZB 1QL7A 2NU2E 3SGQE 2OC8A 1GVKB 2THFB 2UUJB 1TRMA 4NIYA 3ENSB 2XWBI 5ESTE 2BVSH 1OWKA 8KME2 1E34B 1SR5C 3QTOH 1ELBA 4XBDA 3SUDA 1MZDA 2PTCE 1C2FA 2O8LA 2PKSC 1SGQE 5DG6A 1GI8B 4FVBA 1PYTC 3NXPA 4I8GA 5C67A 4JCNA 1LPZB 4TYDA 2WPKS 5L2YH 1XVMA 4IMZA 1RIWC 4X8SH 3VB7A 4ISIH 1YCPK 1SSXA 1CGHA 1V2VT 2EI6A 2ILNA 3SU1A 1K1NA 1GJAB 1UTKA 2VH6A 1MTNB 3V3MA 1DXPA 1GI2A 4CR5A 2B8OH 5L30H 1GBTA 1E36B 1FZZA 2ZP0H 1O33A 1MTNC 2B0FA 3FZDA 3M5OA 2AEIH 3EA9A 1UJ1A 1YPMH 1TBZH 2BDYA 3U1JB 1C9PA 3GISB 1P9UA 1KTSB 1BBRK 1QTFA 1C5XB 2GKVE 3A88A 2P93A 3BTWE 3BV9B 3PLPA 4RKOB 2IPHA 2D2DA 3B9FH 1V6DA 4CREA 2HOBA 2BD7A 1DX5M 2ZQ1A 5CHAB 5JB8S 4H4FA 3RXJA 4J2YB 4CH2B 3BIUH 1GHAF 3EE0B 2H9TH 6ESTA 3KQCA 1O3CA 1NU7B 2BX3A 5CHAC 1GDNA 1GG6B 1V2WT 4INHA 4ZXYH 1O3MA 2NWNA 2R0LA 3IWMA 1O2PA 1GI6A 2CGAA 4JMYA 1NT1A 1OP0A 3PMHB 1D3TB 1HJAB 2ZI2H 3ZZ6A 1GG6C 3U9AH 1QJ1B 2FOFA 1NU9A 3CS0A 1AGJA 5SGAE 3PTNA 1C1NA 3OSYA 1FPCH 2HVXA 1HJAC 2XC4A 3I77A 5G4BA 1EOLA 2BDIA 1K22H 3M5MA 2ZDAH 3TH2H 2ASUB 1FUJA 1LQEA 2XBWA 1C5MD 3RC4A 4YO9A 2AMDA 2BQ6B 2FOHA 4INLA 1L4ZA 2FODA 5FPYA 3A8AA 3EQ0H 4IW4E 4ABFA 4CH8B 1C1QA 2BY8X 3IITA 1BTZA 4JK5A 2HPQH 1EB1H 2QXGA 3SQHE 1IQMA 4R0IA 1Z7KA 3PYHA 1LCYA 3RXIA 3EDXB 3MHWU 1QGFA 4TWYA 1K9OE 2HNTE 4MPWA 2GZ7A 1BA8B 1C5TA 2ZTXA 1PPBH 1VGCC 1GHVH 2R9PA 1IQGA 1HXFH 1HJ9A 2SNVA 2ZEBA 2ZDVH 1DS2E 1W8BH 1O5EH 1NZQH 2A32A 2RDLA 2BB4A 3S9AA 1ZTJA 1T8LA 1C9TA 1VITH 1WQSA 1WV7H 1LKBA 2ZFPH 1UVUH 1SG8B 3LGWA 4NIXA 1C1WH 2Y7XA 1DLKB 2QF3A 9LPRA 2ZGHA 3SU6A 4IN1A 1OWDA 1L2EA 4LZ1H 5HMAA 2BM2A 1MU6B 2ZCHP 1JMOH 2Z3EA 1BHXB 1ZPCA 1N8OB 2GCHF 1BRUP 2BDGA 3BTGE 5A2MH 1FXYA 1PQ8A 4I8JA 1QHRB 1TPPA 4I33A 2VIWA 3ZZAA 1G32B 2RA0A 1EOJA 1YPGH 4NIWA 4ASHA 1GMHG 3RXGA 1FAKH 1TX7A 2Y7ZA 3P17H 1GJ6A 1BHXF 4Y0ZE 3A85A 1FY1A 3SI3H 1G37A 1Z6JH 3B8JA 4JZDH 1GJ7B 1IQNA 1V2PT 1VCQA 2BQ7B 1C1UH 1TBRH 3MYWA 1F92A 1XXDA 4HZHA 1HRTH 3MO9A 4YLQH 2C8ZB 1HB0B 3GCOA 4D9RA 4F49A 2VWOA 3V13A 1TONA 3NPSA 4E7RG 3F68H 3E8LA 2VJ1A 3MH7A 4NG9H 4NWKA 3RMOH 1TLDA 4LK4A 1GJDB 2CV3A 1D3QB 1KY9A 5H4IB 1DM4B 1S6HA 2ZQ2A 1AKSA 2OUAA 3RP2A 1O3EA 3A81A 4RSPA 3F9FA 2OC7A 2VIVA 1AUTC 4NWLA 2PUQH 1GWAA 2FXRA 4RN6A 4YOGA 1QQ4A 3URCA 1MU8B 8LPRA 1ETTH 1NROH 1AB9B 2PSYA 2ZA5A 4X8TH 1OWIA 2P8OC 4WXVA 1WCZA 2GT8A 3ZZ9A 2H2ZA 5DP7A 1AI8H 3QX5H 3UR9A 1M9UA 3UIRA 1GGDB 2HNTC 1IHSH 1HBTH 1S0QA 4BTTB 4BOHA 1P09A 2UWPA 1MTUA 4X6PA 1P0SH 4X8UH 1PPCE 3SNCA 5C20A 1V3XA 5HGGA 2IJOB 1BRCE 4A1TA 3HKJB 1GGDC 3EYDA 2BVXH 3CENA 3TJNA 1P01A 4ZH8A 3S7KB 2QYIA 2TBSA 2TGTA 3P8FA 2ZU1A 5FPSA 3RUOA 2P59A 1NFXA 1UTLM 4GCHF 1MH0A 4NA7A 1MTWA 4YM9A 2FIRH 5DJ7A 5B6OA 1KTTB 1C2JA 1TMBH 3DT0H 1OWJA 1TNGA 3RXPA 3RXSA 2QY0B 2Q6GA 5JBTA 1MBMA 1ELTA 3MO3A 1P04A 1Z8IB 3MNSA 1Y5BT 3QZQA 5EPYA 3U1IB 2FOGA 2OC0A 1QB6A 2Z3DA 4YOJA 1V2OT 5FCKA 1C2DA 3GY4A 2BOKA 1P57B 1YPLH 4B2BA 3E16B 1THRH 2A4RA 1MCTA 1FMGA 2WV5A 3KCGH 1YKTA 3EA8A 4U30A 3PB1E 2G81E 1AKSB 2KAIB 2Q6DA 2OP9A 1GHBF 1ZTKA 1AY6H 1VJAU 1HUTH 2A2XH 1VITG 2BD5A 1OPHB 1DITH 2NU3E 4BANB 1JXPA 4CRGA 2XNIA 3ESTA 2BXUH 1OXGA 2ZHDA 1DSUA 1C1SA 1C5WB 1EX3A 2AIPA 5CMXH 1GVZA 1C5OH 5T6GA 2W7SA 3ZVBA 2J38A 1GI5A 3TK5A 1NPMA 1B0EA 1VCWA 5F8TA 3V7TA 2C93B 4O3UA 1WUNH 2FLBH 4AORA 2GMTC 1O2KA 3U8OH 3L6PA 2ANKH 1P2QA 5AFZH 1HAGE 2XBYA 4B75A 1O2TA 1C5YB 4I8HA 3ZZCA 1UTNA 4WVPE 5C3NA 3T27A 4DIIH 1TB6H 1D3DB 3LT3A 5T6FA 1G3CA 4CRAA 2JH5D 4AGJA 4KTCA 1HDTH 1MAXA 5L2ZH 3VGCB 3ZYDA 1ZSJA 2J2UA 1IOEA 2QN5T 1F2SE 1NN6A 1JOUB 4X1QU 2B9LA 2PTNA 1EAUA 1GBDA 5EW1H 2G00A 2V3OH 1EJAA 1XKAC 3M5NA 4LOYH 3U8TH 3I78A 1AZZA 1K1PA 1GPZA 3E6PH 1T4UH 3TH3H 5FX6A 2P3TB 3IG6B 1SGTA 1BB0B 2F3CE 1MKWH 3TVJB 2JETB 1SLVB 1UK3A 5EW2H 4DT7B 1SL3A 2C4FH 3H5CB 4AYVB 3TGIE 1TMUH 3RXEA 2FX4A 1KXFA 1ZGIA 1F0TA 4Z0KA 1YF4A 5JDUB 1AD8H 1TALA 1S85A 4DCDA 1O3BA 2ODQA 3GY7A 1BTWA 1W2KH 3QWCH 4CBNA 1C5VA 4Q80A 1GBMA 1J15A 1EZSC 1HNEE 4Y11E 1GBLA 3ZVAA 1Y59T 3AAUA 2VGCB 1L1GA 1L1NA 1GBFA 1O38A 1NS3A 1Y5UT 1AVGH 1SFQB 1D3PB 2P3FH 4JZIA 3VB4A 1SB1H 2A0QB 1LHGH 5GJ4B 5K0HA 2R3YA 3L3TA 1YBWA 2WYJA 2VGCC 6CHAB 1GJ4H 1O36A 5C1UA 1O2XA 5EQSA 3LGIA 1PPEE 3KQBA 1BTXA 1EASA 2AS9A 2BY9X 3T28A 4OS4A 1DSTA 2UWOA 3GY5A 5ETXA 2BD8A 6CHAC 3SU3A 2BZ6H 4GSOA 2HGTH 4OS1A 1V2ST 1F0SA 1PQAA 2BD3A 4WF8A 1F5LA 2ANMH 4A7IB 1ELGA 1S83A 1UK2A 1TOMH 4IN2A 4O97A 3M7TA 3LU9B 1VZQH 1GI0A 4X1RU 1LVOA 4FU8A 1BTYA 3A87A 2A1DB 3ZZDA 4XBBA 2ZU5A 1SFIA 1ARBA 1UTPA 3FP7E 4ZKSU 5LPEA 3UREA 5T3HA 4Y7BA 4ABHA 1W7GH 1SGCA 2A2QH 4XSKU 2TGDA 4GHTA 3SJIA 1TE0A 1Z8JB 2ZHWH 1P9SA 3KQDA 1IQJA 1BT7A 1SQAA 3VXFH 4A6LA 4XBCA 2JH0D 1BJUA 5LPRA 2HPPH 3EGKH 4FU7A 2AIQA 4KGAA 3ZZ5A 2AGEX 1HAIH 2P95A 1K28D 2O8UA 2VIQA 4AB8A 5C1XA 2BY5X 1C5PA 1LPGB 2Y5GA 1WYKA 3GY3A 1SMFE 5LGOA 2B5TB 1QB1A 1FLEE 4AZ2B 1PPZA 1C5NH 1DLEA 1GHXH 1T8OA 3DHKH 1L1JA 4B74A 2AFQB 3RXOA 1O39A 1QBOA 1KIGH 1C1MA 3BEIB 1EJNA 1A3EH 4M7GA 1DANH 1ESBA 2J4IA 3TGKE 1TPAE 3RXHA 1LVMA 4FVDA 3CS7A 1P02A 3ITIA 1ELDE 5FCRA 4ISLA 2A5KA 3L33A 1Y3UA 4ABAA 1G3DA 4THNH 2BDHA 1UO6A 1YC0A 1G3EA 3P8OA 2SGPE 1THSH 1Z8RA 5FHTA 3SU5A 2H1UA 2Y5HA 2FTLE 4K2YA 3TIUA 3ZZ8A 3FANA 2PKSB 1QA0A 1FIWA 3ATLA 4CRBA 4MPVA 1PFXC 5LPFA 3RXFA 3PWBA 3QTVH 3SQEE 1QA7A 4KKDA 1EZQA 5IYTA 1SLUB 3M35A 2GDDA 1RIWB 2W7UA 1UTOA 4I32A 2FPZA 4U01A 2GD4B 1ABIH 2WUBA 1P3CA 3DUXH 3E3TA 3F1SB 5EXLA 1AUJA 1BTPA 1EP5A 1TGBA 5EXMA 2TGPZ 1OS8A 2O8MA 1AWFH 3KL6A 4Y6DA 1P05A 2W3KA 3MFJA 1QIXB 4WMFA 1O2QA 5JYIA 7KMEH 3URDA 2ZDMA 1V2TT 1YYY1 2R0KA 5F03A 5FPTA 1GMHF 4UE7H 1H1BA 5E0HA 7GCHG 4DIHH 3U69H 3UOPA 2AH4X 1HFDA 1K1IA 2FTMA 1OSSA 1L4DA 1YP9A 1Z71A 7ESTE 1C1RA 4Q2KA 5TJXA 3K65B 2ALVA 4NA9H 3MU1A 2GCTB 4O9VA 3F6UH 3BTME 3BTKE 2ALPA 1UVSH 2C8XB 5EG4A 1P2NA 1ANBA 5ABWA 4R8TB 5DPAA 4FUHA 4DURA 2GCTC 1RGQA 1O3LA 3ATIA 1MZAA 3RXDA 4UEHH 3UFAA 1ZHRA 2RCEA 2TGAA 1MKXH 3AW0A 3F9HA 1DWEH 1C4U2 1O2YA 3UPEA 3SU2A 3T5FH 2GTBA 5DP8A 4BXSA 2SNWA 1C2GA 5TCCA 1QR3E 3T2NA 4WMDA 3O8CA 1T7CA 2VU8E 3Q3XA 4I8KA 4AGKA 3SU4A 3KHVA 3UOUA 4NFEA 1GDQA 3ELAH 4FXGH 1W0YH 1OX1A 4K5ZA 2F91A 1KXDA 2WYGA 3LPRA 3ZZ4A 2A7CA 2BMGB 3QN7A 3PLKA 1E37B 3KQEA 1OYQA 3S9BA 1EAXA 1EP6A 3AVZA 1ABJH 4DW2U 5JBAS 4OS2A 5F6MA 2OQUA 2BDAA 1CU1A 2Z9GA 2ZFRH 1A5IA 1Z1JA 1GL1A 4FUCA 1NY22 1RTKA 2F9OA 1ESAA 3S7HB 2SGAA 2ZTYA 2ZGBH 1XXFA 3UTUH 5AFYH 3ZVCA 3N7OA 3SJKA 1ZZZA 3RXMA 3P70B 1AN1E 3A89A 1GHZA 1VGCB 1ACBE 1HV7A 4K60A 4MVNA 4Y8ZA 3U8RH 5IDKA 5FBIA 4H6SB 5JBCS 3A86A 1AFQB 1BQYA 3PLBA 4SGBE 5EGMA 2G4TA 4D9QA 4B1TA 3RC5A 4UDWH 3BG8A 1YGCH 1H4WA 2WINI 5EXNA 4BTIB 3SZNA 2VVCA 4FUIA 1GJBB 5HM9A 4BXWA 4H6TA 1AFQC 2Z6BD 2BLVA 3TPIZ 2V3HH 1CE5A 2HWLB 1NFWA 4VGCC 2VIPA 4Q7ZA 2BX4A 4IGDA 1VITF 8GCHG 2VINA 3D65E 1G2LA 5EOKA 1BIOA 3TJUA 2VIOA 1KXAA 3SW2B 1XUGA 2M5TA 2F9PA 1RXPA 4UFDH 3TGJE 1C5UA 1XUFA 3E0NB 5GIBA 1SGIB 4MNYA 2PGBB 1GJ9B 2R3UA 1DT2A 2C90B 2NU1E 2ANWA 3AW1A 1T8MA 3STJA 1EQ9A 2VB0A 3LC5A 4QT8C 4ABJA 5BPEA 1J9CH 2AGGX 2BQWB 5HXFA 2F9NA 4WXIA 1ZR0A 2QC2A 3PWCA 3QGJA 2RA3A 4TWWA 1NO9H 3LH1A 5JB9S 2GGVB 3M7QA 1SGFA 1AHTH 4X2XA 1BUIA 3UQOA 3NUMA 3TH4H 2FEQH 1WSSH 4E7NA 4ZHAA 4X1NU 1QL9A 4ESTE 1OP2A 1MKWK 3PO1B 1QBVH 2XC0A 5EPNA 1KXCA 1HAOH 2FZZA 3ZVGA 1ZTLA 1RS0A 3SV9A 3PO1C 1KSNA 3T25A 3R3GB 2PUXB 1O3PB 1LVBA 2P8OB 1IHTH 1SBWA 4ZAEA 5DGJA 2GX4A 3TK6A 1PQ5A 4Y76A 1CGJE 2Q1JA 3TK9A 3OYPA 1LTOA 4IS5A 3PV4A 2C3SA 1FN8A 3BEFB 3FZZA 3K6YA 1MQ6A 1CSOE 1V2JT 2QA9E 2HNTF 4BAOB 1BZXE 1J14A 2V6NA 1O2SA 1TPOA 1O2LA 5C5OA 3SV2H 3A7VA 3D23A 3F9GA 4JZEH 1BMAA 3F9EA 1O2UA 2BDBA 3AAVA 4E06H 2Z9IA 4B2AA 1TRYA 1FDPA 3KN2A 5I25A 2WPMS 6GCHG 2IN2A 3RMLH 3M3TA 2G52A 4GPGA 1ZRBA 2ULLA 1CQQA 1WBGB 1TNIA 1RRKA 1RTLA 1H8IH 3RMMH 1AIXH 2XWAA 3ODDA 2FOBA 1O5GH 4X2WA 3VEQB 1B0FA 1O2JA 1ELVA 1ZJDA 4X1SU 4Y79A 1PJPA 1ZMLA 1Y3WA 1ZPBA 3SU0A 4B2CA 1ZJKA 2FO9A 4YLUA 1BRBE 1DWDH 1ZHMA 1O32A 1WAYB 2QXHA 3BTFE 1LHDH 1Z8GA 3BG4B 5GCHG 3SNDA 1EPTA 3T26A 4NFFA 4FUBA 3SN8A 1SPJA 4XFQA 2NU0E 1A5HA 1CA8B 1WTHD 3KF2A 1HLTH 1A61H 1GBJA 3BTHE 4I31A 3A8CA 3LKWA 3O8BA 2ZIQH 4MQAA 3MH4A 3RM2H 3BG4C 4FUFA 2WUCA 8ESTE 4CBOA
chains in the Genus database with same CATH superfamily
1GCDA 3SJ8A 2GMTB 1IQHA 3CNRA 2VWMA 4MPXA 2DUCA 1NRNH 4RI0A 1C4V2 1TBQH 2FMJA 4WJG2 2W5EA 1O0DH 1BITA 1F7ZA 4X2VA 2EQNA 3NRLA 1T31A 1GBKA 1P10A 2H5DA 1FY8E 3GDVA 1XUHA 1K1MA 1O2ZA 1FIZA 2CHAB 2J34A 1AVXA 1SGNE 4BAQB 1YPHE 3RXLA 1AFEH 2G4UA 4YT6H 1W0ZU 4NA8A 3WY8A 1A0LA 4KP0A 4A92A 1QRWA 2J98B 1MUEB 1UK4A 2OCVB 1V2KT 5FX5A 1E79D 2CHAC 1QURH 3DFLA 5AVDA 1O3GA 2ZNKH 2ZZUH 3SNBA 1O3KA 2P94A 1BOQA 1HAXB 2O9QA 4XOJA 2FDAA 2GJGA 2R2WU 1XUIA 3F2GA 3BTDE 3ATWA 1TGSZ 4I7YH 2Y80A 1QB9A 2ZC9H 3FP6E 3BIVH 2IJD1 3TJOA 2HLCA 2GZ8A 1O2WA 2B7DH 1CHOG 2J95A 2KCPA 3MMGA 3GDSA 4B6EA 2AGIX 1BMLA 3GCNA 3M5LA 4NSYA 3GYMA 2BDCA 2CF9H 4XRNA 4J1YA 1J17T 1ELCA 1O3OA 2TPIZ 3MI4A 5ESBA 3SV7A 2Y6TA 3W1EA 2A31A 2J92A 1O5FH 3DA9B 3SOSA 1Q3XA 3OTJE 3RXVA 3WWBA 1FY5A 1P3EA 3SO3A 3MQKC 1XM1A 1C1PA 1DE7H 1EPTB 1PYTD 2ZDLA 4ZUHA 3OY6U 1QL8A 4A1XA 4AFSA 4UONA 1C5QA 1ETRH 1H9IE 1QY6A 2G5NA 1W0JD 2XYAA 4K3JA 1LPKB 1J8AA 4AFQA 4CHAC 3HK6B 3RM0H 3TU7H 1FJSA 1W14U 5A8YA 4ZKRU 1RJXB 3B23B 1HIAA 1EPTC 1V2UT 4IMQA 1HAPH 1C5SA 2OBQA 3A8BA 1V2MT 2JKHA 2WPJS 1XKBC 1V2NT 2JH6D 2FLRH 2G5VA 3NK8A 3KEEA 2GP9B 4FUJA 1DICA 1BMMH 4JK6A 4JZFH 1CT4E 4ABEA 1EATA 1WTGH 3BTEE 1TPSA 3P6ZB 1FN6A 4TPIZ 3QLPH 1KLIH 2A7JA 5HYOA 5A09A 1FPHH 1O3FA 1ZRKA 3U98H 1ANEA 1BTHH 1UHBA 4K8YA 2XC5A 3MU5A 3M3SA 1EFRD 3DD2H 1TFXA 1NFUA 4DGJA 3RXCA 3E91A 3BTTE 2PV9B 3QDZB 5GDSH 1NM6A 1VR1H 3QUMP 5CE1A 1Z1IA 4K1SA 4GLYA 1AVWA 2EEKA 7GCHF 2V35A 3D62A 1SGFG 3PMJA 2ZF0H 3A83A 2ZHEH 3E1XB 5T6DA 4FUDA 3LGVA 4MLFB 3LC3A 1YM0A 1SOZA 1UCYE 2ANYA 3QK1A 3ATMA 3MU4A 1ZLRA 1MKXK 4OGXA 1YPHC 3OEED 3TNTA 1TIOA 1GI4A 2OBOA 3ZZ3A 5J4QA 1AU8A 3GY2A 4HGCA 1G3BA 3KNXA 1TNLA 4X8VH 1DDJA 1MTVA 2SGEE 2GZ9A 1TOCB 1HAHH 2BD4A 4JYUH 2VWNA 1HAVA 1S0RA 2VWLA 1O5CB 3U28C 1DY8A 2Z9KA 4Q7YA 2H5CA 1FAXA 2FESH 3RXKA 4AB9A 2QXIA 2D1JA 3A82A 3GCTG 1B5GH 3RU4D 1O2RA 1TMTH 3STIA 1HIAB 2Z94A 3VB6A 5HIZA 1GBHA 1FI8A 2ZPSA 1HJ8A 3VB3A 2EC9H 4F55A 2WPIS 2FOCA 2SGFE 4CRCA 2SGDE 3HKIB 3D49H 1W13U 2ZU4A 4DOQA 2TIOA 5A0BA 5BRRE 2FOEA 2TRMA 4MNWA 2FWWA 3GICB 3LONA 4I8LA 2YOLA 3LOXA 1GI9B 1AO5A 2ZFSA 1IQKA 4D76A 1E38B 1K1JA 1Y3XA 1UHBB 4ISOA 4WH6A 1T4VH 1BMNH 2BXTH 2ZPQA 3PRDA 3SORA 3MOCA 3ZZBA 1IQFA 2NU4E 3F2HA 1NRSH 1UMAH 1WU1A 4TY6A 2GV7A 1SGEE 2Y5FA 1UVPA 1GMCG 4ASUD 2GV6A 3UNRA 4AOQA 3P92A 2GT7A 1A7SA 1XVOA 1LHFH 1X7AC 1GCTB 2PWXA 4K1EA 3MH5A 2O8WA 1D4PB 3SGAE 3ZYEA 4B6FA 2PFEA 1P2JA 2C8WB 1MABB 3I29A 1VCPA 3A7WA 2EA3A 3EE7A 1GCTC 5DK1A 4OGYA 1HAVB 2ZCLP 1OWHA 4LZ4B 5C2ZA 2DE8A 2A5AA 3Q77A 1F5RA 2AMPA 2PKAA 1P2KA 4AFZA 4OS6A 2QF0A 2AYWA 3ZVEA 3EA7A 1FQ3A 3GOVB 4MNXA 1L0ZA 1DPOA 1U6QA 3RMNH 8GCHF 1UCYH 4K8BA 1AZ8A 2XBVA 1SGPE 1THPB 3KYGA 3G01A 1KDQA 3SJOA 2JIZD 2OQ5A 2XTTB 3SV8A 1S5SA 2C8YB 3HATH 1QJ7B 2BY7X 4D7GA 1UVOA 1ZPZA 4MTBA 1LKAA 1C2MA 2D8WA 3KGPA 3A8DA 2OD3B 1NC6A 1MAYA 1P03A 1RFNA 1VJ9U 1PQ7A 3RU4T 1N1LA 1SQRA 4KELA 2ZHFH 2UUKB 3QGNB 2LELA 2A4GA 2UUYA 3O8RA 1YPJH 1F0UA 1AMHA 1C2LA 2OK5A 1T32A 5DKMA 1FV9A 4YESB 1GI7B 4YOIA 1C2KA 3LJOA 3MNXA 4RKJB 1HCGA 2ZDNA 1JWTA 2J9NA 3K2UA 1BJVA 1XX9A 2J94A 1TGNA 1O5AB 4MNVA 1TNJA 3OU0A 3A7ZA 3OEHD 1S84A 4H42U 2PGQB 2Z9LA 3S0NA 2BLWA 1IQEA 1NRPH 2FX6A 1C5LH 2PKAB 4ZKOU 5GPIB 1JRSA 1E1RD 3S69A 1WXRA 1ZMJA 4CR9A 3S9CA 1ZOMA 5DP5A 3UUZA 1ORFA 1IQIA 1UTQA 3TJVA 4NCYA 3LDXH 1GBAA 3M61U 4TSFD 4Z6AH 3MNCA 3M3VA 4Y8YA 2FOMB 4DJZB 1P2OA 3MO6A 1A0JA 5EU8A 4IC6A 5L6NH 3BTQE 4DT4A 2CN0H 1KDQB 1SGYE 1SLWB 1RD3B 2PR3A 3E0PB 4FUGA 1GBBA 2H9HA 4A1VA 5DO4H 5JBBS 5A8ZA 2ODYB 1LQDB 1TRNA 2HALA 1EB2A 1NRRH 4X6MA 3TNSA 1MTSA 1SC8U 3PM3A 5E0JA 1TGCA 3TLOA 1ELFA 3QO6A 3EAJA 1KLTA 4YZUA 3RLWH 2J5UA 1MMJN 3RC6A 2ZHQH 4MG3A 1K1LA 2KCOA 2R2MB 2FYRA 1MBQA 1KMHB 3GY6A 1O5DH 1ZYOA 3OTPA 5JPMH 1C1VH 1GBIA 1PPHE 4TY7A 3HK3B 1PPGE 6GCHF 2L74A 2ZG0H 1GMDG 2F83A 1NBMD 4O03A 3SUFA 3RXRA 2BLOA 4Y8XA 1BBRE 1YPEH 2CF8H 1GBEA 4JYVH 4TPYA 3ZVFA 1DWBH 2QGRA 3UB0A 1YLDA 5C5NA 4VGCB 2O8TA 1WOFA 4NZLA 2KX4A 3A7XA 1H9HE 4X1PU 2CJIA 2VVUA 4D8NA 4ABIA 2BD2A 2ZFFH 1ZSKA 4Y10E 1P2IA 1V2QT 4GHQA 3SI4H 3SNAA 1EZXC 1JRTA 1OP8A 4WH8A 5GCHF 1Q31A 3NKKA 5A0AE 3K9XB 3OAAD 2QIQA 4AX9H 5E2OA 5E8EH 3UNQA 3Q00A 1TNKA 3FFGA 3RXAA 2BZAA 3RXUA 2AERH 4IC5A 1TX8A 1A5GH 4AN7A 2F9BH 4XDEA 1O37A 3PMBB 2FI3E 4Q63A 2ZU2A 5C1YA 3ZV8A 2F9UA 4AFUA 1EJMA 1IAUA 2OC1A 1H8DH 2ZPRA 4ABDA 2Y82A 1D6WA 4ACBA 5F8ZA 1C4Y2 1C1OA 2D26C 2PSXA 2FS9A 1ETSH 1F5KU 4AYYB 1HXEH 1QNJA 1SGDE 5AHGH 2QF5A 4AG1A 4FOUC 5LH8A 3A80A 1C5RA 4UFFH 2ZGJA 1Q2WA 5HM2A 4HFPB 4CRDA 2XCFA 3OY5U 3ZVDA 2G55A 3ATKA 2FI5E 1YCPM 2BLQA 4I86A 3Q76A 1N8OC 2WV4A 2P3UB 1LHEH 3SHAH 2XCNA 4CRFA 3WWFA 2ZECA 2STBE 4UFEH 2A7HA 2VIDA 4DY7B 3UQVA 1NBME 2BHGA 5EQRA 1CHOF 1Z6EA 3F0OA 5DP4A 5C94A 1YCPH 3UNSA 4D7FA 1QRZA 1GI1A 2HLDD 1LDTT 1A2CH 3MNBA 6LPRA 5FBEA 3A7YA 4U32A 1G9IE 1JBUH 1QQUA 1DXWA 2VVVA 1ELEE 1A46H 3DSGA 1LVYA 3DFJA 3SJ9A 2G51A 1AE5A 2AMQA 2BY6X 1MD7A 2XOKD 3NCLA 4NGAH 2ZGCA 1UW7A 1FONA 3PRBA 3UY9A 3M7UA 1GHAG 1BBRH 1GJCB 1XUJA 1V2LT 3SHCH 1Y5AT 4YT7H 2KAIA 4F4OC 4Y7AA 1YPKH 5EODA 3LJJA 5DP3A 3H7TA 4P00A 5FAHA 1DFPA 3GYLB 3TITA 2QCYA 1FNIA 2FS8A 2OTVA 1DWCH 2LNCA 1C1TA 1TGTA 3P8NA 3BEUA 3UR6A 3SGBE 3HPTB 3V0XA 1DUAA 1TWXB 1P06A 5E0GA 1AB9C 4GAWA 3GY8A 1OOKB 1GDUA 3C1KA 5F53A 1CVWH 1EXFA 1GBCA 4ZROA 3VXEH 1T8NA 2STAE 1PPFE 3MU0A 4B76A 4IBLH 4XE4A 1E35B 2ZCKP 2GVFA 4NSVA 1C2HA 1CBWB 1SI5H 1SLXB 2EI8A 2IOTA 2K1QA 1UVTH 2LPRA 3ZV9A 1O2NA 4NIVA 3HGPA 2SGQE 4ZMAH 2ZFQH 1O30A 3R0FA 3E90B 1CBWC 1D6RA 3KIDU 1G36A 5EIYA 4SGAE 1CT0E 2ZTZA 1G2MA 5FXLA 1C2IA 1CA0B 1UTJA 3NWUA 1ZMNA 1SVPA 4ISHH 3ODFA 4KTUA 1DUEA 3RXBA 3RLYH 3OX7U 1H9LB 3W95A 1LMWB 3K6ZA 1Y3YA 1SOTA 1A3BH 1A1RA 2Z3CA 2FM2A 1CA0C 1Y8TA 3GCTF 4INKA 1B7XB 1LO6A 3PROA 2FOAA 1CGIE 4DG4A 3LGYA 1N6YA 1V2RT 4ABGA 3SV6A 1E0FD 2FP7B 1JIRA 1OWEA 1FY4A 3KYFA 3MTYA 2ZKSA 1HYLA 1MCVA 3MU8A 2Z9JA 2HRVA 2Y81A 3NZIA 3P95A 4KTSA 1KXEA 1AQ7A 2EI7A 3MWIU 2QV1A 3T29A 2ODPA 1K2I1 3HGNA 2FI4E 1ID5H 4MPUA 1QRXA 2YNBA 1P2MA 2GCHG 1GJ5H 2SFAA 2XXLA 3A7TA 3SUEA 1N6XA 2WPLS 3LH3A 4M9FA 1O35A 2Q6FA 1SQOA 4HTCH 2KZ4A 2RDEA 3PTBA 4WMEA 1S82A 2BVRH 1O2MA 1P11E 1Y3VA 2A4OA 2PP6A 1GMCF 1TNHA 3JZ2B 1IQLA 3C27B 1O3AA 3VFEA 5DP6A 4BTUB 2OINA 1YLCA 3Q3YA 1MD8A 1O3HA 1O3DA 3PMAB 1DVAH 4BAHB 1ANCA 4CHAB 1S6FA 1W12U 1D9IA 4X0WU 1UCYK 1HPGA 2ESTE 2A4QA 4P02A 1J16A 4X2YA 1DY9A 1OYTH 1GI3A 5E2PA 2ZFTA 2CXVA 1GL0E 4LXBH 3VGCC 1NESE 2XW9A 1QBNA 3AASA 2I6SA 1XUKA 1W3CA 3UWIA 5I46H 5DP9A 1EZUC 1ELAA 1EAIA 1SHHB 2G8TA 3M36A 1KXBA 4GVUA 2BOHB 2QF4A 3Q3KA 2V7QD 4Y71A 2OXSA 1W10U 1KLJH 2H9EH 4WWYA 5F8XA 1GHWH 5A8XA 2QAAA 4PROA 4ZHMU 3VB5A 1TA2A 1YWUA 2JETC 4A5TS 2PHBA 3M37A 4ZXXH 1KYNA 2ZU3A 1ZSLA 2AHME 4B71A 1QFKH 3FP8E 3MH6A 4X6OA 5J4SA 3LIWA 4NZQA 4U2WA 2FYQA 4DVAU 1OKXA 2W26A 4ABBA 1O3JA 2OLGA 2W3IA 1EUFA 1O34A 4AG2A 1HAZB 1O2GH 2UWLA 3T62A 3GDUA 2VH0A 4BAMB 1ARCA 4UFGH 4K1TA 1AWHB 1BCUH 1CT2E 2H6MA 1GVLA 4GCHG 2P16A 1FY3A 3P8GA 2I6QA 1SQTA 3OFND 2ZGXH 4BAKB 5AF9H 1QJ6B 1ESTA 1K21H 5PTPA 1TA6A 1GHYH 1NTPA 2JJ1D 3BSQA 1SKYE 1G30B 2RFKC 1O5BB 3BF6H 3SBKA 4ZKNU 5DN6D 4HG6A 2WHXA 3LGTA 4OS7A 3A84A 3O8DA 1S81A 4B73A 2Z7FE 1A0HB 1TQ0B 4JZ1A 1W11U 4UD9H 1SHYA 2QXJA 1W7XH 1O2VA 1TAWA 3RXQA 3SUGA 1GHBG 1F0RA 4FU9A 1FX0B 1NRQH 1O31A 1CO7E 4MDSA 1INCA 2A45B 3BN9A 1K1OA 5C0UA 5TCAA 1O3NA 3ZZ7A 1ZHPA 2UUFB 2KR7A 2XRCA 1RTFB 4K69A 2CMYA 2YNAA 1SGRE 2ZO3H 4BNRA 2DE9A 3GCHB 3QZRA 4O3TA 4YTAA 1CHGA 1EAWA 3LGUA 1JIMA 1ANDA 5C0TA 1BDAA 3FAOA 3W94A 4ISNA 1LHCH 5EQQA 2XBXA 2V0BA 4JYTA 3GCHC 1COWD 3CP7A 2A5IA 2VNTA 1TX6A 3JZ1B 4GUXA 3DSPA 5K7RA 1ZGVA 1O2IA 1P8VC 2BTCE 1BTUA 4ZHLU 1WQVH 5EJ1A 3UWJH 1TQ7B 2WPHS 1EKBB 1O2HA 4Q7XA 5GXPA 1BRAA 9ESTA 4HI3A 1A4WH 3RDZA 1DOJA 1GMDF 2PW8H 1TYNA 1GJ8B 1O2OA 1NFYA 3H7OA 2BD9A 1C2EA 1W0KD 4WY3A 3RXTA 1XMNB 2ZDKA 2BYAX 2RG3A 5GWZA 3FVFB 3SNEA 2ZWLH 7LPRA 2GDEH 3V12A 4X6NA 1HGTH 1MQ5A 2F9VA 1QCPA 1O3IA 4ZCNA 1P12E 4FUEA 1UTMA 4E05H 1TABE 4OS5A 5A0CA 4Y0YE 1HAYB 2PLXA 3KQ5A 1AE8H 3H09A 1C5ZB 1QL7A 2NU2E 3RU4E 3SGQE 5C17A 2OC8A 1GVKB 2THFB 2UUJB 1TRMA 3F3BA 5IK2D 4NIYA 3ENSB 2XWBI 5ESTE 2BVSH 1OWKA 8KME2 1E34B 1SR5C 3QTOH 1ELBA 4XBDA 3SUDA 1MZDA 2PTCE 1C2FA 2O8LA 2PKSC 1SGQE 5DG6A 1GI8B 4FVBA 1PYTC 3NXPA 4I8GA 5C67A 4JCNA 1LPZB 4TYDA 2WPKS 5L2YH 1XVMA 4IMZA 1RIWC 4X8SH 3VB7A 4ISIH 1YCPK 1SSXA 1CGHA 1V2VT 2EI6A 2ILNA 3SU1A 1K1NA 1GJAB 5KECA 1UTKA 2VH6A 1MTNB 3V3MA 1DXPA 1GI2A 4CR5A 2B8OH 5L30H 1GBTA 1E36B 1FZZA 2ZP0H 1O33A 1MTNC 2B0FA 3FZDA 3M5OA 2AEIH 3EA9A 1UJ1A 1YPMH 1TBZH 2BDYA 3U1JB 1C9PA 3GISB 1P9UA 1KTSB 1BBRK 1QTFA 1C5XB 2GKVE 3A88A 2P93A 4RT1A 3BTWE 3BV9B 3PLPA 4RKOB 2IPHA 2D2DA 3GS9A 3B9FH 1V6DA 4CREA 2HOBA 2BD7A 1DX5M 2ZQ1A 5CHAB 5JB8S 4H4FA 3RXJA 4J2YB 4CH2B 3BIUH 1GHAF 3EE0B 2H9TH 6ESTA 3OE7D 3KQCA 1O3CA 1NU7B 2BX3A 5CHAC 1GDNA 1GG6B 1V2WT 4INHA 4ZXYH 1O3MA 2NWNA 2R0LA 3IWMA 1O2PA 2YMSD 1GI6A 2CGAA 4JMYA 1NT1A 1OP0A 3PMHB 4YXWD 1D3TB 1HJAB 2ZI2H 3ZZ6A 1GG6C 3U9AH 1QJ1B 2FOFA 1NU9A 3CS0A 1AGJA 5SGAE 3PTNA 1C1NA 3OSYA 1FPCH 2HVXA 1HJAC 2XC4A 3I77A 5G4BA 1EOLA 2BDIA 1K22H 5HIYA 3M5MA 2ZDAH 3TH2H 2ASUB 1FUJA 1LQEA 2XBWA 1C5MD 3RC4A 4YO9A 2AMDA 2BQ6B 2FOHA 4INLA 1L4ZA 2FODA 5FPYA 3A8AA 3EQ0H 4IW4E 4ABFA 4CH8B 1C1QA 2BY8X 3IITA 1BTZA 4JK5A 2HPQH 1EB1H 2QXGA 3SQHE 1IQMA 1YLNA 4R0IA 1Z7KA 3PYHA 1LCYA 3RXIA 3EDXB 3MHWU 1QGFA 4TWYA 1K9OE 2HNTE 4MPWA 2GZ7A 1BA8B 1C5TA 2ZTXA 1PPBH 1VGCC 1GHVH 2R9PA 1IQGA 1HXFH 1HJ9A 2SNVA 2ZEBA 2ZDVH 2XNDD 1DS2E 1W8BH 1O5EH 1NZQH 2A32A 2RDLA 2BB4A 3S9AA 1ZTJA 1T8LA 1C9TA 1VITH 1WQSA 1WV7H 1LKBA 2ZFPH 1UVUH 1SG8B 3LGWA 4NIXA 1C1WH 2Y7XA 1DLKB 2QF3A 9LPRA 2ZGHA 3SU6A 4IN1A 1OWDA 1L2EA 4LZ1H 5HMAA 2BM2A 1MU6B 2ZCHP 3DCLA 1JMOH 2Z3EA 1BHXB 1ZPCA 1N8OB 2GCHF 1BRUP 2BDGA 3BTGE 5A2MH 1FXYA 1PQ8A 4I8JA 1QHRB 1TPPA 4I33A 2VIWA 3ZZAA 1G32B 2RA0A 1EOJA 1YPGH 4NIWA 4ASHA 1GMHG 3RXGA 1FAKH 1TX7A 2IPQX 2Y7ZA 3P17H 1GJ6A 1BHXF 1YY3A 4Y0ZE 3A85A 1FY1A 3SI3H 1G37A 1Z6JH 3B8JA 4JZDH 1GJ7B 1IQNA 1V2PT 1VCQA 2BQ7B 2J97A 1C1UH 1TBRH 1F92A 1XXDA 3MYWA 4HZHA 1HRTH 3MO9A 4YLQH 2C8ZB 1HB0B 3GCOA 4D9RA 4F49A 2VWOA 3V13A 1TONA 3NPSA 4E7RG 3F68H 3E8LA 2VJ1A 3MH7A 4NG9H 4NWKA 3RMOH 1TLDA 4LK4A 1GJDB 2CV3A 1D3QB 1KY9A 5H4IB 1DM4B 1S6HA 2ZQ2A 1AKSA 2OUAA 3RP2A 1O3EA 3A81A 4RSPA 3F9FA 2OC7A 2VIVA 1AUTC 2W6ID 4NWLA 2PUQH 1GWAA 2FXRA 4RN6A 4YOGA 1QQ4A 3URCA 1MU8B 8LPRA 1ETTH 1NROH 1AB9B 2PSYA 2ZA5A 4X8TH 1OWIA 2P8OC 4WXVA 1WCZA 2GT8A 3ZZ9A 2H2ZA 5DP7A 1AI8H 3QX5H 3UR9A 1M9UA 1S6LA 2WPDD 3UIRA 3WW7A 1GGDB 2HNTC 1IHSH 1HBTH 1S0QA 4BTTB 4BOHA 1P09A 2UWPA 1MTUA 4X6PA 5HKKD 1P0SH 4X8UH 1PPCE 3SNCA 5C20A 1V3XA 5HGGA 2IJOB 1BRCE 4A1TA 3HKJB 1GGDC 3EYDA 2BVXH 3CENA 3TJNA 1P01A 4ZH8A 3S7KB 3FN8A 2QYIA 2TBSA 2TGTA 3P8FA 2ZU1A 5FPSA 3RUOA 2P59A 1NFXA 1UTLM 4GCHF 1MH0A 4NA7A 1MTWA 4YM9A 2FIRH 5DJ7A 5B6OA 5T1VA 1KTTB 1C2JA 1TMBH 3DT0H 1OWJA 1TNGA 3RXPA 3RXSA 2QY0B 2Q6GA 2YMSC 5JBTA 1MBMA 1ELTA 3MO3A 1P04A 1Z8IB 3MNSA 1Y5BT 3QZQA 5EPYA 3U1IB 2FOGA 2OC0A 1QB6A 2Z3DA 4YOJA 1V2OT 5FCKA 1C2DA 3GY4A 5FL7D 2BOKA 1P57B 1YPLH 4B2BA 3E16B 1THRH 2A4RA 1MCTA 1FMGA 2WV5A 3KCGH 1YKTA 3EA8A 4U30A 3PB1E 1BMFD 2G81E 1AKSB 2KAIB 2Q6DA 2OP9A 1GHBF 1ZTKA 1AY6H 1VJAU 1HUTH 2A2XH 1VITG 2BD5A 1OPHB 2LP6A 1DITH 2NU3E 4BANB 1JXPA 1QZ8A 4CRGA 2XNIA 3ESTA 2BXUH 1OXGA 2ZHDA 1DSUA 1C1SA 1C5WB 1EX3A 2AIPA 5KGOA 1GVZA 5CMXH 1C5OH 5T6GA 2W7SA 3ZVBA 2J38A 1GI5A 3TK5A 1NPMA 1B0EA 1VCWA 5F8TA 3V7TA 2C93B 4O3UA 1WUNH 2FLBH 4AORA 2GMTC 2JDID 1O2KA 3U8OH 3L6PA 2ANKH 1P2QA 5AFZH 1HAGE 2XBYA 4B75A 1O2TA 1C5YB 4I8HA 3ZZCA 1UTNA 4WVPE 5C3NA 3T27A 4DIIH 1TB6H 1D3DB 3LT3A 2KCYA 5T6FA 1G3CA 4CRAA 2JH5D 4AGJA 3SYJA 4KTCA 1HDTH 1MAXA 5L2ZH 3VGCB 3ZYDA 1ZSJA 2J2UA 1IOEA 2QN5T 1F2SE 1NN6A 1JOUB 4X1QU 2B9LA 2PTNA 1EAUA 1GBDA 5EW1H 2G00A 2V3OH 4Z1MD 1EJAA 1XKAC 3M5NA 4LOYH 3U8TH 3I78A 1AZZA 1K1PA 1GPZA 3E6PH 1T4UH 3TH3H 5FX6A 2P3TB 3IG6B 1SGTA 1BB0B 2F3CE 1MKWH 4TT3D 3TVJB 2JETB 1E1QD 1SLVB 1UK3A 5EW2H 4DT7B 1SL3A 2C4FH 3H5CB 4AYVB 3TGIE 5EJLA 1TMUH 3RXEA 2FX4A 5EJZA 1KXFA 1ZGIA 1F0TA 4Z0KA 1YF4A 5JDUB 3VPKA 1AD8H 1TALA 1S85A 4DCDA 1O3BA 2ODQA 3GY7A 1BTWA 1W2KH 3QWCH 4CBNA 1C5VA 4Q80A 1GBMA 1J15A 1EZSC 1HNEE 4Y11E 1GBLA 3ZVAA 1Y59T 3N99A 3AAUA 2VGCB 1L1GA 1L1NA 1GBFA 1O38A 1NS3A 1Y5UT 1AVGH 1SFQB 1D3PB 2F43B 2P3FH 4JZIA 5GNDA 3VB4A 1SB1H 2A0QB 1LHGH 5GJ4B 5K0HA 2R3YA 3L3TA 1YBWA 2WYJA 2VGCC 4RT0A 6CHAB 1GJ4H 1O36A 5C1UA 1O2XA 5EQSA 3LGIA 1PPEE 3PV5A 3KQBA 1BTXA 1EASA 2AS9A 2BY9X 3T28A 4OS4A 1DSTA 2UWOA 3GY5A 5ETXA 2BD8A 6CHAC 3SU3A 2BZ6H 4GSOA 3VG8A 2HVYB 2HGTH 4OS1A 1V2ST 1F0SA 1PQAA 2BD3A 4WF8A 1F5LA 2ANMH 4A7IB 1ELGA 1S83A 1UK2A 1TOMH 4IN2A 4O97A 3M7TA 3LU9B 1VZQH 2M2AA 1GI0A 4X1RU 1LVOA 4FU8A 1BTYA 3A87A 2A1DB 3ZZDA 4XBBA 2ZU5A 1SFIA 2WSSD 1ARBA 1UTPA 3FP7E 4ZKSU 5LPEA 3UREA 5T3HA 3DSOA 4Y7BA 4ABHA 1W7GH 1SGCA 2A2QH 4XSKU 2V3MA 2TGDA 4GHTA 3SJIA 1TE0A 1Z8JB 2ZHWH 1P9SA 3KQDA 1IQJA 1BT7A 1SQAA 3VXFH 4A6LA 4XBCA 2JH0D 1BJUA 5LPRA 2HPPH 3EGKH 4FU7A 2AIQA 4KGAA 3ZZ5A 2AGEX 1HAIH 2P95A 1K28D 2O8UA 2KFWA 2VIQA 4AB8A 5C1XA 2BY5X 1C5PA 1LPGB 2Y5GA 1WYKA 2W6JD 3GY3A 2VBCA 1SMFE 5LGOA 2L6OA 2B5TB 1QB1A 1FLEE 4AZ2B 1PPZA 1C5NH 1DLEA 1GHXH 1T8OA 3DHKH 5CDFE 1L1JA 4B74A 3F2FA 2AFQB 3RXOA 1O39A 1QBOA 1KIGH 1C1MA 3BEIB 1EJNA 1A3EH 4M7GA 1DANH 1ESBA 2J4IA 3TGKE 1TPAE 3RXHA 1LVMA 4Q4LA 4FVDA 3CS7A 1P02A 3ITIA 1ELDE 5FCRA 4ISLA 2A5KA 3L33A 1Y3UA 4ABAA 1G3DA 4THNH 2BDHA 1UO6A 1YC0A 1G3EA 3P8OA 2SGPE 1THSH 1Z8RA 5FHTA 3SU5A 2H1UA 2Y5HA 2FTLE 4K2YA 3TIUA 3ZZ8A 3FANA 2PKSB 1QA0A 1FIWA 1H8HD 3ATLA 4CRBA 4MPVA 1PFXC 5LPFA 3F0PA 4OM9A 3RXFA 3PWBA 3QTVH 3SQEE 1QA7A 4KKDA 1EZQA 5IYTA 1SLUB 3M35A 2GDDA 1RIWB 3AK5A 2W7UA 1UTOA 1H8ED 4I32A 2FPZA 4U01A 2GD4B 1ABIH 2WUBA 1P3CA 3DUXH 3E3TA 3F1SB 5EXLA 1AUJA 1BTPA 1EP5A 1TGBA 5EXMA 2TGPZ 1OS8A 2O8MA 1AWFH 3KL6A 4Y6DA 1P05A 2W3KA 3MFJA 1QIXB 4WMFA 1O2QA 5KEDA 5JYIA 7KMEH 3URDA 2ZDMA 1V2TT 1YYY1 2R0KA 5F03A 5FPTA 1GMHF 4UE7H 1H1BA 4F48B 5E0HA 7GCHG 4DIHH 3U69H 3UOPA 2AH4X 1HFDA 1K1IA 2FTMA 1OSSA 5DSFA 1L4DA 1YP9A 1Z71A 7ESTE 1C1RA 4Q2KA 5TJXA 3K65B 2ALVA 4NA9H 3MU1A 2GCTB 2QE7D 4O9VA 3F6UH 4ACAA 3BTME 3BTKE 2ALPA 1UVSH 2C8XB 5EG4A 1P2NA 1ANBA 5ABWA 1OHHD 4R8TB 3N7DA 5DPAA 4FUHA 4DURA 2GCTC 1RGQA 1O3LA 3ATIA 1MZAA 3RXDA 4UEHH 3UFAA 1ZHRA 2RCEA 2TGAA 1MKXH 3AW0A 3F9HA 1DWEH 1C4U2 1O2YA 3UPEA 3SU2A 3T5FH 2GTBA 5DP8A 4BXSA 2SNWA 1C2GA 5TCCA 1QR3E 3T2NA 4WMDA 2EY4C 3O8CA 5B6LA 1T7CA 2VU8E 3FO8D 3Q3XA 4I8KA 4AGKA 3SU4A 3KHVA 3UOUA 2CK3D 4NFEA 1GDQA 3ELAH 4FXGH 1W0YH 1OX1A 4K5ZA 2F91A 1KXDA 2WYGA 3LPRA 5CHBA 3ZZ4A 2A7CA 2BMGB 3QN7A 3PLKA 1E37B 3KQEA 1OYQA 3S9BA 1EAXA 1K0HA 1EP6A 3AVZA 1ABJH 4DW2U 5JBAS 4OS2A 5F6MA 2OQUA 2BDAA 1CU1A 2Z9GA 2ZFRH 1A5IA 1Z1JA 1GL1A 4FUCA 1NY22 1RTKA 2F9OA 1ESAA 3S7HB 2SGAA 2ZTYA 2ZGBH 1XXFA 3UTUH 5AFYH 3ZVCA 3N7OA 3SJKA 1ZZZA 3RXMA 3P70B 1AN1E 3A89A 1GHZA 1VGCB 1ACBE 1HV7A 4K60A 4MVNA 4Y8ZA 3U8RH 5IDKA 5FBIA 4H6SB 5JBCS 3A86A 1AFQB 1BQYA 3PLBA 4SGBE 5EGMA 2G4TA 4XD7D 4D9QA 4B1TA 3RC5A 4UDWH 3BG8A 1YGCH 1H4WA 2WINI 5EXNA 4BTIB 3SZNA 2JJ2D 2VVCA 4FUIA 1GJBB 1VKYA 5HM9A 4BXWA 4H6TA 1AFQC 2Z6BD 2BLVA 3TPIZ 2V3HH 1CE5A 2HWLB 1NFWA 4VGCC 2K0QA 2VIPA 4Q7ZA 2BX4A 4IGDA 3UAIC 1VITF 8GCHG 2VINA 3D65E 1G2LA 5EOKA 1BIOA 3TJUA 2VIOA 1KXAA 3SW2B 1XUGA 2M5TA 2F9PA 1RXPA 2KCAA 4UFDH 1C5UA 1XUFA 3E0NB 5GIBA 3TGJE 1SGIB 4MNYA 2PGBB 1GJ9B 2R3UA 3ZIAD 1DT2A 2C90B 2NU1E 2ANWA 3AW1A 1T8MA 3STJA 3PV2A 1EQ9A 2VB0A 3LC5A 4QT8C 4ABJA 5BPEA 1J9CH 2AGGX 2BQWB 5HXFA 2F9NA 4WXIA 1ZR0A 2QC2A 3PWCA 3QGJA 2RA3A 4TWWA 1NO9H 3LH1A 5JB9S 2GGVB 3M7QA 1SGFA 1AHTH 4X2XA 1BUIA 3UQOA 3NUMA 3TH4H 2FEQH 1WSSH 4E7NA 4ZHAA 4X1NU 1QL9A 4ESTE 2WZQA 1OP2A 1MKWK 3PO1B 1QBVH 2XC0A 5EPNA 1KXCA 1HAOH 3FOAA 2FZZA 3ZVGA 1ZTLA 1RS0A 3SV9A 3PO1C 1KSNA 3T25A 3R3GB 2PUXB 1O3PB 1LVBA 2P8OB 1IHTH 1SBWA 4ZAEA 5DGJA 2GX4A 3TK6A 1PQ5A 4Y76A 1CGJE 2Q1JA 3TK9A 3OYPA 1LTOA 4IS5A 3PV4A 2C3SA 1FN8A 3BEFB 1WDIA 3FZZA 3K6YA 1MQ6A 1CSOE 1V2JT 2QA9E 2HNTF 4BAOB 1BZXE 1J14A 2V6NA 1O2SA 1TPOA 4FETA 1O2LA 5C5OA 3SV2H 3A7VA 3D23A 3F9GA 4JZEH 1BMAA 2K8IA 3F9EA 2YMSB 1O2UA 2BDBA 3AAVA 2J98A 2Z9IA 4E06H 4B2AA 1TRYA 1FDPA 2F4LA 3KN2A 5I25A 2WPMS 6GCHG 2IN2A 3RMLH 3M3TA 2G52A 4GPGA 1ZRBA 2ULLA 1CQQA 1WBGB 1TNIA 2KM0A 1RRKA 1RTLA 1H8IH 3RMMH 1AIXH 2XWAA 3ODDA 2FOBA 1O5GH 4X2WA 3SZEA 3VEQB 1B0FA 1O2JA 1ELVA 1ZJDA 4X1SU 4Y79A 1PJPA 1ZMLA 1Y3WA 1ZPBA 3SU0A 4B2CA 1ZJKA 2FO9A 4YLUA 1BRBE 1DWDH 1ZHMA 3N7EA 1O32A 1WAYB 2QXHA 3BTFE 1LHDH 1Z8GA 3BG4B 5GCHG 3SNDA 1EPTA 3T26A 4NFFA 4FUBA 3SN8A 1SPJA 4XFQA 2NU0E 1A5HA 4AC9A 1CA8B 1WTHD 3KF2A 1HLTH 1A61H 1GBJA 3BTHE 4I31A 3A8CA 3LKWA 3O8BA 2ZIQH 4MQAA 3MH4A 3RM2H 3BG4C 4FUFA 2WV9A 3FKSD 2WUCA 8ESTE 4CBOA
chains in the Genus database with same CATH topology
1GCDA 3SJ8A 2GMTB 1IQHA 2VWMA 4MPXA 2DUCA 1NRNH 1C4V2 1TBQH 2FMJA 4WJG2 2W5EA 1O0DH 1BITA 1F7ZA 4X2VA 1T31A 1GBKA 1P10A 2H5DA 1FY8E 3GDVA 1XUHA 1K1MA 1O2ZA 1FIZA 2CHAB 2J34A 1AVXA 1SGNE 4BAQB 1YPHE 3RXLA 1AFEH 2G4UA 4YT6H 1W0ZU 4NA8A 3WY8A 1A0LA 4KP0A 4A92A 1QRWA 5FX5A 1MUEB 1UK4A 2OCVB 1V2KT 2CHAC 1QURH 3DFLA 5AVDA 1O3GA 2ZNKH 2ZZUH 3SNBA 1O3KA 2P94A 1BOQA 1HAXB 2O9QA 4XOJA 2FDAA 2R2WU 1XUIA 3BTDE 3ATWA 1TGSZ 4I7YH 2Y80A 1QB9A 2ZC9H 3FP6E 3BIVH 3TJOA 2HLCA 2GZ8A 1O2WA 2B7DH 1CHOG 2J95A 3MMGA 3GDSA 2AGIX 1BMLA 3GCNA 3M5LA 4NSYA 3GYMA 2BDCA 2CF9H 3VPKA 4J1YA 1J17T 1ELCA 1O3OA 2TPIZ 3MI4A 5ESBA 3SV7A 2Y6TA 2A31A 2J92A 1O5FH 3DA9B 3SOSA 1Q3XA 3OTJE 3RXVA 1FY5A 1P3EA 3SO3A 1XM1A 1C1PA 1DE7H 1EPTB 1PYTD 2ZDLA 4ZUHA 3OY6U 1QL8A 4A1XA 4AFSA 4UONA 1C5QA 1ETRH 1H9IE 1QY6A 2G5NA 2XYAA 4K3JA 4AFQA 1LPKB 1J8AA 4CHAC 3HK6B 3RM0H 3TU7H 1FJSA 1W14U 5A8YA 4ZKRU 1RJXB 3B23B 1HIAA 1EPTC 1V2UT 4IMQA 1HAPH 1C5SA 2OBQA 3A8BA 1V2MT 2JKHA 2WPJS 1XKBC 1V2NT 2JH6D 2FLRH 2G5VA 3NK8A 3KEEA 2GP9B 4FUJA 1DICA 1BMMH 4JK6A 4JZFH 1CT4E 4ABEA 1EATA 1WTGH 3BTEE 1TPSA 3P6ZB 1FN6A 4TPIZ 3QLPH 1KLIH 2A7JA 5HYOA 5A09A 1FPHH 1O3FA 1ZRKA 3U98H 1ANEA 1BTHH 1UHBA 4K8YA 2XC5A 3MU5A 3M3SA 3DD2H 1TFXA 1NFUA 4DGJA 3RXCA 3E91A 3BTTE 2PV9B 3QDZB 5GDSH 1NM6A 1VR1H 3QUMP 5CE1A 1Z1IA 4K1SA 4GLYA 1AVWA 2EEKA 7GCHF 2V35A 3D62A 1SGFG 3PMJA 2ZF0H 3A83A 2ZHEH 3E1XB 5T6DA 4FUDA 3LGVA 4MLFB 3LC3A 1YM0A 1SOZA 1UCYE 2ANYA 3QK1A 3ATMA 3MU4A 1ZLRA 1MKXK 4OGXA 1YPHC 3TNTA 1TIOA 1GI4A 2OBOA 3ZZ3A 5J4QA 1AU8A 3GY2A 4HGCA 1G3BA 3KNXA 1TNLA 4X8VH 1DDJA 1MTVA 2SGEE 2GZ9A 1TOCB 1HAHH 2BD4A 4JYUH 2VWNA 1HAVA 1S0RA 2VWLA 1O5CB 1DY8A 2Z9KA 4Q7YA 2H5CA 1FAXA 2FESH 3RXKA 4AB9A 2QXIA 2D1JA 3A82A 3GCTG 1B5GH 3RU4D 1O2RA 1TMTH 3STIA 1HIAB 2Z94A 3VB6A 1GBHA 1FI8A 2ZPSA 1HJ8A 3VB3A 2EC9H 2WPIS 2FOCA 2SGFE 4CRCA 2SGDE 3HKIB 3D49H 1W13U 2ZU4A 4DOQA 2TIOA 5A0BA 5BRRE 2FOEA 2TRMA 4MNWA 2FWWA 3GICB 3LONA 4I8LA 2YOLA 3LOXA 1GI9B 1AO5A 2ZFSA 1IQKA 4D76A 1E38B 1K1JA 1Y3XA 1UHBB 4ISOA 4WH6A 1T4VH 1BMNH 2BXTH 2ZPQA 3SORA 3MOCA 3ZZBA 1IQFA 2NU4E 1NRSH 1UMAH 1WU1A 4TY6A 2GV7A 1SGEE 2Y5FA 1UVPA 1GMCG 2GV6A 3UNRA 4AOQA 3P92A 2GT7A 1A7SA 1XVOA 1LHFH 1X7AC 1GCTB 2PWXA 4K1EA 3MH5A 2O8WA 1D4PB 3SGAE 3ZYEA 2PFEA 1P2JA 2C8WB 3I29A 1VCPA 3A7WA 2EA3A 1GCTC 5DK1A 4OGYA 1HAVB 2ZCLP 1OWHA 4LZ4B 5C2ZA 2DE8A 2A5AA 3Q77A 1F5RA 2AMPA 2PKAA 1P2KA 4AFZA 4OS6A 2QF0A 2AYWA 3ZVEA 3EA7A 1FQ3A 3GOVB 4MNXA 1L0ZA 1DPOA 1U6QA 3RMNH 8GCHF 1UCYH 4K8BA 1AZ8A 2XBVA 1SGPE 1THPB 3G01A 1KDQA 3SJOA 2OQ5A 2XTTB 3SV8A 1S5SA 2C8YB 3HATH 1QJ7B 2BY7X 4D7GA 1UVOA 1ZPZA 4MTBA 1LKAA 1C2MA 2D8WA 3KGPA 3A8DA 2OD3B 1NC6A 1MAYA 1P03A 1RFNA 1VJ9U 1PQ7A 3RU4T 1N1LA 4KELA 2ZHFH 2UUKB 3QGNB 2A4GA 2UUYA 3O8RA 1YPJH 1F0UA 1AMHA 1C2LA 1T32A 5DKMA 1FV9A 4YESB 1GI7B 4YOIA 1C2KA 3LJOA 3MNXA 4RKJB 1HCGA 2ZDNA 1JWTA 2J9NA 3K2UA 1BJVA 1XX9A 2J94A 1TGNA 1O5AB 4MNVA 1TNJA 3OU0A 3A7ZA 1S84A 4H42U 2PGQB 2Z9LA 3S0NA 2BLWA 1IQEA 1NRPH 2PKAB 1C5LH 2FX6A 4ZKOU 5GPIB 1JRSA 3S69A 1ZMJA 4CR9A 3S9CA 1ZOMA 5DP5A 3UUZA 1ORFA 1IQIA 1UTQA 3TJVA 4NCYA 3LDXH 1GBAA 3M61U 4Z6AH 3MNCA 3M3VA 4Y8YA 2FOMB 4DJZB 1P2OA 3MO6A 1A0JA 5EU8A 4IC6A 5L6NH 3BTQE 2CN0H 1KDQB 1SGYE 1SLWB 1RD3B 2PR3A 3E0PB 4FUGA 1GBBA 2H9HA 4A1VA 5DO4H 5JBBS 5A8ZA 2ODYB 1LQDB 1TRNA 2HALA 1EB2A 1NRRH 4X6MA 3TNSA 1MTSA 1SC8U 3PM3A 5E0JA 1TGCA 3TLOA 1ELFA 3QO6A 3EAJA 1KLTA 4YZUA 3RLWH 1MMJN 3RC6A 2ZHQH 4MG3A 1K1LA 2R2MB 2FYRA 1MBQA 3GY6A 1O5DH 1ZYOA 5JPMH 1C1VH 1GBIA 1PPHE 4TY7A 3HK3B 1PPGE 6GCHF 2ZG0H 1GMDG 2F83A 4O03A 3SUFA 3RXRA 2BLOA 4Y8XA 1BBRE 1YPEH 2CF8H 1GBEA 4JYVH 4TPYA 3ZVFA 1DWBH 2QGRA 1YLDA 5C5NA 4VGCB 2O8TA 1WOFA 4NZLA 3A7XA 1H9HE 4X1PU 2CJIA 2VVUA 4D8NA 4ABIA 2BD2A 2ZFFH 1ZSKA 4Y10E 1P2IA 1V2QT 4GHQA 3SI4H 3SNAA 1EZXC 1JRTA 1OP8A 4WH8A 5GCHF 1Q31A 3NKKA 5A0AE 3K9XB 2QIQA 4AX9H 5E2OA 5E8EH 3UNQA 3Q00A 1TNKA 3FFGA 3RXAA 2BZAA 3RXUA 2AERH 4IC5A 1TX8A 1A5GH 4AN7A 2F9BH 4XDEA 1O37A 3PMBB 2FI3E 5C1YA 2ZU2A 3ZV8A 2F9UA 4AFUA 1EJMA 1IAUA 2OC1A 1H8DH 2ZPRA 4ABDA 2Y82A 1D6WA 5F8ZA 1C4Y2 1C1OA 2D26C 2PSXA 2FS9A 1ETSH 1F5KU 4AYYB 1HXEH 1QNJA 1SGDE 5AHGH 4AG1A 5LH8A 3A80A 1C5RA 4UFFH 2ZGJA 1Q2WA 5HM2A 4HFPB 4CRDA 2XCFA 3OY5U 3ZVDA 2G55A 3ATKA 2FI5E 1YCPM 2BLQA 3Q76A 1N8OC 2WV4A 2P3UB 1LHEH 3SHAH 2XCNA 4CRFA 2ZECA 2STBE 4UFEH 2A7HA 2VIDA 4DY7B 3UQVA 2BHGA 5EQRA 1CHOF 1Z6EA 5DP4A 1YCPH 3UNSA 4D7FA 1QRZA 1GI1A 1LDTT 1A2CH 3MNBA 6LPRA 5FBEA 3A7YA 4U32A 1G9IE 1JBUH 1QQUA 1DXWA 2VVVA 1ELEE 1A46H 1LVYA 3DFJA 3SJ9A 2G51A 1AE5A 2AMQA 2BY6X 1MD7A 3NCLA 4NGAH 2ZGCA 1FONA 3UY9A 3M7UA 1GHAG 1BBRH 1GJCB 1XUJA 1V2LT 3SHCH 1Y5AT 4YT7H 2KAIA 4F4OC 4Y7AA 1YPKH 5EODA 3LJJA 5DP3A 3H7TA 5FAHA 1DFPA 3GYLB 3TITA 2QCYA 1FNIA 2FS8A 2OTVA 1DWCH 2LNCA 1C1TA 1TGTA 3P8NA 3BEUA 3UR6A 3SGBE 3HPTB 3V0XA 1DUAA 1TWXB 1P06A 5E0GA 1AB9C 4GAWA 3GY8A 1OOKB 1GDUA 3C1KA 1CVWH 1EXFA 1GBCA 4ZROA 3VXEH 1T8NA 2STAE 1PPFE 3MU0A 4B76A 4IBLH 4XE4A 1E35B 2ZCKP 2GVFA 4NSVA 1C2HA 1CBWB 1SI5H 1SLXB 2EI8A 2IOTA 2K1QA 1UVTH 2LPRA 3ZV9A 1O2NA 4NIVA 3HGPA 2SGQE 4ZMAH 2ZFQH 1O30A 3R0FA 3E90B 1CBWC 1D6RA 3KIDU 1G36A 4SGAE 1CT0E 2ZTZA 1G2MA 5FXLA 1C2IA 1CA0B 1UTJA 3NWUA 1ZMNA 1SVPA 4ISHH 3ODFA 4KTUA 1DUEA 3RXBA 3RLYH 3OX7U 1H9LB 3W95A 1LMWB 3K6ZA 1Y3YA 1SOTA 1A3BH 1A1RA 2Z3CA 2FM2A 1CA0C 1Y8TA 3GCTF 4INKA 1B7XB 1LO6A 3PROA 2FOAA 1CGIE 4DG4A 3LGYA 1N6YA 1V2RT 4ABGA 3SV6A 1E0FD 2FP7B 1JIRA 1OWEA 1FY4A 3MTYA 2ZKSA 1HYLA 1MCVA 3MU8A 2Z9JA 2HRVA 2Y81A 3NZIA 3P95A 4KTSA 1KXEA 1AQ7A 2EI7A 3MWIU 2QV1A 3T29A 2ODPA 1K2I1 3HGNA 2FI4E 1ID5H 4MPUA 1QRXA 2YNBA 1P2MA 2GCHG 1GJ5H 2SFAA 2XXLA 3A7TA 3SUEA 1N6XA 2WPLS 3LH3A 1O35A 2Q6FA 1SQOA 4HTCH 3PTBA 4WMEA 1S82A 2BVRH 1O2MA 1P11E 1Y3VA 2A4OA 1GMCF 1TNHA 3JZ2B 1IQLA 3C27B 1O3AA 3VFEA 5DP6A 4BTUB 2OINA 1YLCA 3Q3YA 1MD8A 1O3HA 1O3DA 3PMAB 1DVAH 4BAHB 1ANCA 4CHAB 1S6FA 1W12U 1D9IA 4X0WU 1UCYK 1HPGA 2ESTE 2A4QA 1J16A 4X2YA 1DY9A 1OYTH 1GI3A 5E2PA 2ZFTA 2CXVA 1GL0E 4LXBH 3VGCC 1NESE 2XW9A 1QBNA 3AASA 2I6SA 1XUKA 1W3CA 3UWIA 5I46H 5DP9A 1EZUC 1ELAA 1EAIA 1SHHB 2G8TA 3M36A 1KXBA 4GVUA 2BOHB 3Q3KA 4Y71A 2OXSA 1W10U 1KLJH 2H9EH 4WWYA 5F8XA 1GHWH 5A8XA 2QAAA 4PROA 4ZHMU 3VB5A 1TA2A 2JETC 4A5TS 2PHBA 3M37A 4ZXXH 1KYNA 2ZU3A 1ZSLA 4B71A 1QFKH 3FP8E 3MH6A 4X6OA 5J4SA 3LIWA 4NZQA 4U2WA 2FYQA 4DVAU 1OKXA 2W26A 4ABBA 1O3JA 2OLGA 2W3IA 1EUFA 1O34A 4AG2A 1HAZB 1O2GH 2UWLA 3T62A 3GDUA 2VH0A 4BAMB 1ARCA 4UFGH 4K1TA 1AWHB 1BCUH 1CT2E 2H6MA 1GVLA 4GCHG 2P16A 1FY3A 3P8GA 2I6QA 1SQTA 2ZGXH 4BAKB 5AF9H 1QJ6B 1ESTA 1K21H 5PTPA 1TA6A 1GHYH 1NTPA 3BSQA 1G30B 1O5BB 3BF6H 3SBKA 4ZKNU 3LGTA 4OS7A 3A84A 3O8DA 1S81A 4B73A 2Z7FE 1A0HB 1TQ0B 4JZ1A 1W11U 4UD9H 1SHYA 2QXJA 1W7XH 1O2VA 1TAWA 3RXQA 3SUGA 1GHBG 1F0RA 4FU9A 1NRQH 1O31A 1CO7E 4MDSA 1INCA 2A45B 3BN9A 1K1OA 5TCAA 1O3NA 3ZZ7A 1ZHPA 2UUFB 2XRCA 1RTFB 4K69A 2CMYA 2YNAA 1SGRE 2ZO3H 4BNRA 2DE9A 3GCHB 3QZRA 4O3TA 4YTAA 1CHGA 1EAWA 3LGUA 1JIMA 1ANDA 1BDAA 3FAOA 3W94A 4ISNA 1LHCH 5EQQA 2XBXA 2V0BA 4JYTA 3GCHC 3CP7A 2A5IA 2VNTA 1TX6A 3JZ1B 4GUXA 5K7RA 1ZGVA 1O2IA 1P8VC 2BTCE 1BTUA 4ZHLU 1WQVH 3UWJH 1TQ7B 2WPHS 1EKBB 1O2HA 4Q7XA 5GXPA 1BRAA 9ESTA 4HI3A 1A4WH 3RDZA 1DOJA 1GMDF 2PW8H 1TYNA 1GJ8B 1O2OA 1NFYA 3H7OA 2BD9A 1C2EA 4WY3A 3RXTA 1XMNB 2ZDKA 2BYAX 2RG3A 5GWZA 3FVFB 3SNEA 2ZWLH 7LPRA 2GDEH 3V12A 4X6NA 1HGTH 1MQ5A 2F9VA 1QCPA 1O3IA 1P12E 4FUEA 1UTMA 4E05H 1TABE 4OS5A 5A0CA 4Y0YE 1HAYB 2PLXA 1AE8H 3RU4E 1C5ZB 1QL7A 2NU2E 3SGQE 2OC8A 1GVKB 2THFB 2UUJB 1TRMA 4NIYA 3ENSB 2XWBI 5ESTE 2BVSH 1OWKA 8KME2 1E34B 1SR5C 3QTOH 1ELBA 4XBDA 3SUDA 1MZDA 2PTCE 1C2FA 2O8LA 2PKSC 1SGQE 5DG6A 1GI8B 4FVBA 1PYTC 3NXPA 4I8GA 5C67A 4JCNA 1LPZB 4TYDA 2WPKS 5L2YH 1XVMA 4IMZA 1RIWC 4X8SH 3VB7A 4ISIH 1YCPK 1SSXA 1CGHA 1V2VT 2EI6A 2ILNA 3SU1A 1K1NA 1GJAB 1UTKA 2VH6A 1MTNB 3V3MA 1DXPA 1GI2A 4CR5A 2B8OH 5L30H 1GBTA 1E36B 1FZZA 2ZP0H 1O33A 1MTNC 2B0FA 3FZDA 3M5OA 2AEIH 3EA9A 1UJ1A 1YPMH