1A0QH

29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
205
Chain Sequence
VQLQESDAELVKPGASVKISCKASGYTFTDHVIHWVKQKPEQGLEWIGYISPGNGDIKYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYLCKRGYYVDYWGQGTTLTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the crystallographic structures of two catalytic antibodies with esterase activity.
pubmed doi rcsb
molecule tags Catalytic antibody
molecule keywords 29G11 FAB (LIGHT CHAIN)
total genus 42
structure length 205
sequence length 216
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a0qH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a0qH02
2ZCKL 3IJHB 1KLFA 4PLOB 5J1AA 5TQ2L 1QO3A 1V5JA 5D72L 4OF3A 4DZBB 3V0WL 5C0EB 1A6PA 4DGIL 3PGCA 4POYA 5E5UB 4GKZB 1P6AB 1U8QB 5DJYB 4PRPA 3CDYA 3QDJA 4HD9A 3EKCA 2XG5A 3F8UB 4P2QA 5DD0H 1IEAA 1AHWA 5I8CB 5JORB 3P77A 1H3XA 3CGTA 4WI2A 3ZDXF 5C8JB 4HUNB 2KBGA 1A0QH 5D5MA 5J1TC 5D2NE 1NMCC 5EC2A 2HJLB 3LV3A 1OARH 1RD6A 1AFVL 4Y4FC 2IPTH 4WFED 3I75A 2JJVA 4L29A 2D03L 4B53A 3SDXA 3BUYB 3O6ML 2DYPA 3R0NA 4EI5C 4XNUH 5F88B 4YDKH 2NY1C 5E2JA 4DZ8B 1M4KA 1SYVA 1T1WA 1CFTB 5F93C 3OJDB 3BD4A 3V8CA 3HNVL 4LVHC 5LQBH 3PGFL 3CFBA 3VDCA 3BEVA 4S1RL 5FV1L 5K9JH 3KR3L 2JJSC 3OKLA 4JCMA 5IFAH 5TQ2H 5D7IA 3Q6GL 3QRGL 1MREH 1BQHA 1ZLUH 5C0CB 4GG6B 3AS1A 3LRSA 4JN1H 4OI7A 2CDGA 2NY5C 1XCQB 2PXYD 2B2XL 2VERN 2XZAH 3KHQA 4YH6A 3P4MA 4OGZA 2HMID 1DLHB 4AG4H 7CGTA 4H25B 4OCSH 1OWRM 2PETA 5IG7B 1F4AA 2OJEA 4LSSL 5CWSA 3DMMB 3P73A 3OKKB 3VH8G 3IJYB 3L3IB 4BH7B 3WIIL 5CJXA 3FO1B 3T0AA 3M8OH 3SKMA 1EJOL 3IDIA 4G7YL 3OZ9H 2YS4A 2FGZA 5T5NF 5EBLA 3WFEH 5CP7A 4OLXH 4QHKI 1FZOB 4N90E 2P8MA 4RA3A 5HPMB 3HI6L 3MV9E 3AM8A 2YPLA 3DYOA 1P5VA 1H0DB 2NY6C 3GMRA 4Y16D 2DJSA 3PHOB 1J0JA 1R3HB 4JKWA 2BK8A 4FRWA 2DQFB 4UZGA 5D7IE 4KKLD 2J4WH 1CWVA 1W8NA 4EKXA 4PJ8B 4NSKA 3QEQB 1CLYH 4PJXE 1ZMYA 3D3VE 3IAQA 1AHWC 4Z7WE 4QCIB 4Y4FD 3SE9H 3KXFB 4ESKA 1IM3B 3VJ6A 4HXBL 5JXAL 2AXJA 4J12A 4QRQA 5D96B 5JIPA 3C8KB 5TDNA 5E99H 2A6DB 1TZIA 3QIWB 4LDEB 4JFOB 3FRUA 4PJDF 4Y4FA 1RURH 5GRUH 4G3YH 4GKNB 4F2MB 1OY3B 1T0MA 2VWEE 4ISVA 1C5DA 3DXAD 4LU5L 3QZWG 2EKSA 4P2RE 3E3QE 4MHHI 4AH2A 4FFWC 3MJ7B 1H8NA 3Q1SL 4XPTH 2FEEI 3I50H 2DRUA 3VXRA 4LF3B 5IFJA 1MFBH 3S5LB 1SYVB 1T1WB 4YX2L 3UTTD 5CJBA 1XGPB 5B21A 2B5IC 4MJ2A 2D7MA 4U1LB 1X5FA 3WV0A 4Z0XB 5CEYB 3UTTA 3CIQA 4JY5L 3I6KA 2FLRT 2R0LH 3QNYA 2ZOKA 2AERT 4U1SB 3IS0X 3PQYE 5F96H 5GGTL 4X5LA 4JHBA 3K81A 4K9EC 1IGJB 3NCJL 4XPTL 1URLA 4K3JH 2QQLL 2NW2A 1K5NB 3SKNA 3BH8B 2NXYB 4Y5XC 1NGPL 2Q86A 5AD0B 2F54D 4CW1A 1JIBA 3EIFA 1G0YR 1VFAA 3GSNA 2E7LC 3LN5B 1R3IH 3IKKA 4BSVA 4WY7H 1WIOA 1CL7H 2JCCB 1H5BC 2WBJD 3RNQB 3DX6B 4TSCL 1XGQA 1MCOH 1UB6B 1E4JA 4R26H 4X7EC 3EDDA 5IEKA 4PJ7E 4JZNA 1BVKA 4M6OL 3GJFB 2FGWL 2QQNL 4PD4J 4PTUB 5DLML 5DRNB 2EIBA 2NMSA 3ETBF 1M71A 2PTVA 4IOIB 3K46A 4HS8L 2WNGA 1X5GA 4APQC 4KDWA 4D3CL 1WFUA 4BYHA 1UT9A 3HMWH 1JE6A 4PBVC 4UDTA 4MJID 4ZOCA 4ZYKB 3RKDD 4P23A 1INEL 1GC1L 1VDGA 4N5EC 4AQ1B 4CJ1A 4G7YH 1MEXL 1A6VH 4CADB 2C4XA 3BN3B 1IKNC 1E6OL 3GFUA 3CUPB 3O3DA 4NRZA 2WWKO 1Q72L 2BP3A 1G1CA 2CR6A 2CUMA 8FABA 3MLVH 4OCXH 4CN4A 2ZCHL 2YPKA 3PF2A 3VFMA 3D9AH 3GIZH 1ZT1A 1FORH 5C0AD 1EA9C 4JFHD 4ACPA 2D9QB 5FXCH 4Q9CA 5KSAC 4FQPA 2V7HB 1VEMA 4LVOB 4WO4A 4RNRA 2YBRB 3PE9A 4HUXB 4NUGL 1A7QL 3GRWL 2YKLH 1M7XA 1PVHA 4HW6A 3NPZB 1RHFA 1RZFL 3MUJA 1X44A 3NCJH 4HPOL 5HGBB 2XICA 4LLUB 1QFWI 5KSUB 3T1FB 2Y36L 4X4ZA 1DQJB 4ODVL 3SEPA 1YNKH 5IB3A 4DEPC 3MUGA 1X4XA 5E9DB 4WNQB 4KRPB 3N1MC 1NCUA 4ZSOA 4U3HA 2FATH 5HD8D 4B7LA 1A2YB 3ZDZF 1YMMB 3C6LA 2HMIC 1WISA 3G08B 1P1ZB 1YEEH 3V8OA 2WIMA 3MJ9L 5LQBL 4WW1B 2GJ6E 5DS8B 1ZEAH 1CCZA 4HIIA 1BOGB 2R23B 3T0EC 3SDAC 1CE6B 1RHHA 2XXMB 2P44B 4LHUG 5E99L 1YYLH 1S5HB 2EDDA 1A1MB 3BIKA 4L4TE 2VNCA 2NY1D 2LU4A 1HEZA 1CICD 2AJUH 4EI5D 5BRZA 3D0VA 3EOBA 1IT9H 3GSRA 1NAMH 4LKCA 2Q3AA 2DQTH 2X89A 3SDCA 3UYOD 4QRRA 3QUZA 5CMAB 4EEEA 2DKUA 1JUFA 3Q5TA 2YN3A 4S1QH 2LVEA 5HHXH 1GOHA 4DZBA 2VDNH 3QI9A 1KUMA 4C54A 1MRFL 2BRQA 1GVIA 2GSGB 5CUSL 5DUPL 5FB8B 1UWXH 1XZ0A 1IGCH 4KRNA 2APVA 1RK1B 4LCYA 4P4KA 3WFCL 4KRPC 3VG9B 2OCFD 3LQMA 4JGUA 2MOVA 3G6JF 4EQ3A 3LZFL 4HS3A 2VIRA 4S1QL 1IFHL 2W1NA 1IEBB 5KG9B 2ADGA 5C0RH 3KJ4C 4X6FB 2P5ED 5CHNB 5EIIB 4FFWD 1VHPA 1OLLA 3VA6A 1T5XB 5HHOA 1AP2B 2AJUL 1UJ3A 1M7IB 4FZEL 2OZ4L 4JR9L 4OKVA 1J7VR 5IBUB 5EDXA 4V2CB 2X70B 2Z93B 4DW2H 1C08B 4AEFA 2IH3A 2AJ3A 1YEJL 1H3TA 2W0PA 1MQ8A 3FFDB 5DSCB 2J8UB 3OKYA 5T1LD 1TVBB 4YPGA 2VXSL 3LKSA 4U2YA 2EDJA 3W0WB 1G6RH 3A67L 1HYRC 5T3ZD 3FOLB 3UROR 5DO2D 5F97E 1U8PB 1RZGA 3MRGB 3H9HB 1BGXH 1Y6NR 4N0RA 4Y19D 1RU9H 3BPOB 3RTQC 2NY4C 1CE1L 4MQXD 5I30L 1XMWA 2J8UF 4EDXB 3UPCA 3ULVL 1UG9A 2PO6A 3BGMA 1T1YA 4HWUA 4N68A 4YAQA 1OTTD 2AXGB 3S98A 1GOFA 4R0LB 3NIDF 2EDXA 4QTHA 4OBRA 5B4MC 1WQVT 1XCTA 2VLRB 4GW5B 4LCCC 5DK2B 2CLRB 3OB8A 5HDBF 3VWJC 1SEBB 4J23A 1H0DA 2J88L 1RVFH 4ZOEA 1KCVH 1QSFA 4EI6A 4PLJD 4ELKA 5DVLA 1IAKB 3LS4L 2FZ3B 2DIBA 4JM2F 5A2IH 2F58H 3MRMB 4LSUH 3ZL4L 1N0XL 3CLFH 3LEXB 5I8KH 5KW9L 4FNLL 2P1YA 3OX8A 1F3RB 3ILQD 4OGXL 1GGBH 1XGQB 2BJMH 4KJPD 5TJWK 3SDAB 5DYOB 3RZCB 3DSFH 4FQ1L 2G5RA 3ARSA 3P0VL 1ZS8A 2BC4A 2CDEB 5E56A 4OD1L 3SGJA 1JHTB 1WWBX 3HNTL 2NLJA 5ANMB 3E1F1 1MHCA 4PUBL 3MJ6A 5DK0A 1NAML 4ZYKA 5HVHB 2WBJA 4ZO7A 4U6VL 5IHZA 4G6ML 4D9LL 1HXYA 2XV6B 1JJUA 2V17H 4XT1C 5F9WC 3QDGD 2VL4A 2X9WA 5CBAA 2A6DA 1HINH 1CN4A 2NY6B 5JOPD 3VWKC 4MQSB 2R1XA 4Z7VF 4KK8D 2FB4H 4NZTH 5DDHA 5DZOA 5HHNA 3UJTL 4ZOAA 2QQQA 1R6VA 5DFTA 5DMGC 2Q7NA 3OXRA 4G80A 3FAWA 1LNUB 2GCYA 5SWSB 4P2OB 4DVRL 1U8NA 5I8CA 5J9PB 4GKNA 4G8GD 9CGTA 1UM5H 4R7DA 4Y19E 3O6FA 4G6KL 3L1OH 5IFJB 3L1OL 4FXKA 4MDIA 1NC4D 5DMYA 4GAGH 3U4BH 4OZHF 2EDLA 2RIKA 1B0WA 1S7UA 4L8DB 3O6FD 5KAQF 1LO3L 4XPBL 1YNKL 3HLAB 3LQZA 1CK0L 1XGYL 3TA3D 1U8OB 4U1GC 3KPRA 4NC1C 1JPST 3VXUB 4OLEA 2X4QB 15C8L 4XBEH 3DV6B 1OARL 3VI3E 2W0KA 3E2HB 1R3JA 4MNGA 3O3AB 4OIAA 5EORL 1MFAH 1H5BA 4XAWL 3P40A 2VLJE 1BJ1J 1CFSB 2AK4E 3IDNB 5MI0C 2VDRL 1HI6B 5IEHA 4KZDH 2K7QA 2DKSA 1MCPL 2CDGB 3EFFB 3KPMB 1CD8A 4K94H 4CGTA 1EGJL 4ODSH 3TVMA 4HV8A 3DO7B 4NUJB 4PG2C 3PXJA 5ABDE 1G1YA 3PIQB 1A6TB 4JDZB 3L3KB 2MSPA 1L7IH 5DRWB 1UM4H 4JRXE 5ERWB 4CADA 5KOMC 1YNTB 3H0TA 3ZMRA 4NJ9H 1WFNA 2MQ0A 4PJCF 4YK4C 1X5HA 3HC3L 4NQDE 5DURD 5E8PA 1EEQA 1DANT 1PZ5B 3KPSD 1TVDA 1JZ3A 3JTSB 3ROOB 1I9RH 4DKAA 2IBZX 2IGFL 2YPLB 3P0GB 2G75B 1B4JH 4OD3L 4E5XB 4LASH 3KPSE 1S7RB 1F00I 5I6XB 1U42A 1W0VB 3GMPA 1CI5A 5F7DB 4ZFOA 1QFHA 1HHHB 1IGCL 2IBBA 2G9HA 1DE4A 3EO0A 4K3JL 4OF8A 3I6GB 4KPHH 2EZ0D 3NAAL 5HGDB 2CMRH 5E5MA 1I1CA 3HS0A 3U83A 4XX1E 2YD7A 3MGAA 3EAKA 3VFMB 4CMMA 3LN4B 5SWSA 4L5FH 1UA6H 1WCBA 1FVEB 3ZYOA 1LK3H 1FN4A 3AREC 2JJUA 4FXKB 3ZT6A 5T1KA 3CXDL 1I9IH 1IEBA 4I2XB 1KT2A 2EDHA 1P7QB 1W2KT 4I1NB 3RTQA 2CO6B 1ZANL 1U3HC 3I9GH 2DQHL 3EYQC 5E6ID 2CLVA 1NGYB 1I1RA 2ICEB 3IJSA 1OTSD 1A7OH 3WIHL 3KPRB 3L5WB 1PEWA 4GRLA 1NCBL 4XC3L 1A6WH 2BDNL 1ORSB 5FKAA 4NN5C 5CINL 5ETUA 1XGPA 3SOBH 4Z7WA 4PJ7B 4ONFL 3D3VA 2PW2A 5AUMA 4MD5B 5EIQA 2HTLD 5GHWH 5GXBB 4Z0XA 3R8QA 1MFCL 1WBYB 1ADQH 1C12A 4GJTB 1BVLB 1MFBL 3EJZC 5SWZA 5ICZA 4JM2D 43C9B 5HYJA 3TH4T 2CRZA 3PL6B 3P9LA 2YPLE 1KPVB 5FYJH 3MRPA 3PIQA 2EDWA 5IMKA 1JGEB 4NHCH 4U6VH 1U8PA 4EI6B 1SJXA 4JDTH 3VA2C 3NH7H 1AO7D 5EOTB 4EUPH 1S9YA 3BP7A 3BJ91 4EVNB 2K1MA 2EH8H 4WJ5A 3GJEA 4C4KT 1MCDA 3KVQA 3RWJB 4O2CA 5HGHB 2P49B 4K2UH 4WWKD 1T4KA 4U6XA 4Z77B 5BJTB 1QVOA 3RVXC 5DVMA 3BZFB 4PGDA 3V0WH 5L9DL 1RIVL 4CN6A 4U33A 2I9LA 5IB2A 1DFBH 4LHUB 2C3HA 4F8QA 1B90A 5F1KC 2UY6A 5HGAA 5IJKC 1NCAL 1QBML 3E0GA 4M48H 3G04A 1RZJH 4P2RB 2XYCA 4X4ME 1SM3H 5INCA 3V6OA 5KSVB 1F3JB 4KK5C 1SJEB 3CU1A 3B9KD 4ONGL 3RU8L 1LD9B 4M7JH 25C8H 1ZT4A 2VDLH 3A0OA 1UACL 1FL6A 1LO4L 5SWQB 2H41A 4YBLB 4TUKL 1G7PB 4OQ1A 5IR1A 4IDJL 2FX7L 5FB8A 4MNQE 1X3DA 5GJSL 3C2AH 4EN3A 2VUYA 3UX9B 4XX1G 1WJ3A 1TVBA 4AMKH 1TQCB 5JW4M 1A9EB 4S1DC 2E7HA 1CTOA 3ET9F 4FQJH 4J4PD 4NM8H 4QHUA 5J8OA 2DQTL 2KH2B 3FB5B 1AP2A 1TLKA 3MBED 2Y25A 4M1DL 1C5BH 1HXYB 4NOBA 2VQTA 2DDQH 4HHAA 2ADGB 1VEPA 5A16B 3H9HA 2CRMA 2X42A 3HUJF 3RDTC 2GYSA 1L7IL 2X70A 2Z93A 3GSUB 1WK0A 3K2UH 1C08A 1CDIA 4Z5RA 4S11A 4XCCL 4QRPB 4Y5XB 5L88H 2JIXB 5DC0A 4XPAH 2BVQB 2AEQL 4JPIA 1HDMA 1NGPH 3SO3C 1WBZB 4XWGH 3QIBC 3NTCL 2YUZA 1ROWA 5I18H 3ZE2F 1J86A 1RZFH 4U0QB 3H42L 5DJ6A 5C71A 1JK8B 2GTWB 3X12A 3MPCA 3X3FH 2DQCH 3CH1A 2VLLB 4K94C 3FFDA 1OSZB 3VXMD 3F7PC 3BP5B 1FO0H 5KVFL 3RWIA 4C56D 3J8F7 4UOW1 1U8HB 3H3PH 4QGTA 3NIDE 4O5LL 4OFYD 1UZ6E 1ND0B 1S7XB 4XHJD 5KN5B 4EBQH 3GBMH 2UWEE 3GIVB 1T21B 2X4SA 4KI5D 2Y36H 1WZKA 3C5SB 2V5MA 4JKKA 3P4NA 2EE9A 1YJDL 3X13A 2AK4A 2OR9L 1MHHB 1E6JH 2F74B 4RIRA 2DI9A 4M7KH 4MNGE 2P43B 3D0VB 1SM3L 2BOCB 2NLJB 4LKCB 4J3OC 4QRRB 4NN6B 4P48A 1PEZA 1G7MA 4NDMA 5CMAA 3EDJA 4MDJB 1VPOH 3QIBD 2DBLH 3RIFK 5JMOC 1ZA3B 5IMLB 1W0WA 5HVWA 4PG9A 3QUXB 2RCSL 2HT4D 3BAEL 4LOUC 5CBAB 1MH5B 3VCLA 5BZWA 3AREA 3RWHA 4PR5B 4G9DB 1EGJA 2BNQA 2R0KL 2DTSA 1G9NL 1AD0A 3QULA 1JHTA 2DBJA 1EO8L 5CGYC 5JR1H 2Y06L 2ADIA 3AFLA 2AEPL 5ALCH 4QKXB 5KTEL 1HKLH 3SGEH 2MTPA 1HILB 3T4YA 3JV4A 4TVPE 3DVGA 4LSRL 5A43C 2JELH 4OV6F 3TIDB 5INDB 1LEIA 3QQ3A 5A16A 4NHCL 3SGDH 1D6VL 1I3VA 1QBLH 2D7QA 4JKLA 4PJGB 4IEFB 4WV1A 4MAYD 5DGQA 4KMTL 2PF6A 2YR3A 4NM4L 3CLFL 2J8OA 3C87A 3HTLX 3FQTA 2Z31B 2G2RA 5GGQH 5E4EC 4ORGA 2IH3B 2AW2A 2QHLA 3T0EB 1QEWB 4GKSB 1FVDA 4HGWB 1MCQA 2OL3H 5TDPB 2LTQC 5FCUL 4K8RD 4WGWB 3ULUD 2X4UA 4X8XA 5MEOB 1QFUH 5IOPA 3M07A 4QRRE 1A9BB 2C3GA 4M7LL 5FKPB 1U41A 2B4CH 4M9OA 4L1HA 1DEEB 3AM8C 2X9XA 5J6HA 5L2JA 3QWOA 4RAUA 5TDOA 2RQ8A 3V0VA 4HIEB 4NO5B 1NANI 3EFDL 2XZZA 4X7SL 3WKMH 5HHVH 1YYMH 4Z7OF 4RGMC 2HFFA 5ESAB 4WJ5B 5B38B 2ZCHH 3TGXA 3DUSA 3MRFA 1LWRA 3RWJA 3D18B 1OAZH 4RMQA 1ZA6B 4LSTH 4FG6C 3OAUH 2OZ4A 3TBWA 4P99A 3SDDA 4MSWA 1YN7A 2IANA 4W81A 1X4ZA 5T3ZL 3B9AA 1BQLL 4YHIB 4HJJL 4EOWH 4LGPB 1F4HA 4N0YL 5IHLB 5ESVB 4CVXA 2Z8SA 1PY9A 4PY8J 4G9DA 3QP3A 1LDPL 3GJEB 1AI1H 3VWKA 2FJHA 2FJGB 3DECA 1Q9KB 3ELAT 2UWEB 2Z8VC 3G6DL 4S2SA 1YEDB 2CUHA 5IHBA 3V5KA 3PWNB 5BRZD 3RL1A 1PZUB 1P9MC 1WTGT 3LS5H 4PGDB 4E5XA 2GI7A 5E6IC 4Z0BL 4MXVF 3NPSC 1FNEA 4WI9A 1UCBH 1WSST 2VWEC 3BEWA 3KWWB 3RDTA 3OB0K 3SJVB 5L0QB 1IKNA 4QCIA 1J8HE 1H3GA 1NCWL 3MRLA 3S5LA 2DM2A 4MX7A 2W65B 2BNQE 3VI3F 2AQ1A 3BKMH 1DBKH 3LKPB 4XAWH 5J89A 1DBMH 4ETYA 2ED9A 1FAKT 2MKWA 2CD0A 4IS6A 4MD5A 4HZAA 4ORZC 4L9LC 4RFNC 4LRIC 5F3BB 3HE6A 1UVQB 1CF8L 1II4E 5J3HD 3BGFB 5BZDA 3TJHC 4JM4H 1NAKH 2N56A 1U93A 1JK8A 4QOKD 2FBOJ 2GJZB 4RQQB 4YE4L 2ICEA 5GRJH 1CDYA 4HLZH 3VFWB 4JN1L 1XF1A 3VXPB 2DQGH 5I1GL 3H9SD 4APQB 3T3ME 1QLRA 3QIUC 2V2WB 4MJ6A 4XWGL 1RJCA 1NCDH 3QEHA 1NANH 2YWZA 1NAMA 4XCNB 3L95A 1KIQB 3CX2A 1BQHB 2VKXA 1FFPB 4R7NA 3F12A 4LAQL 4CNIA 4K71C 3O3AA 4HXBH 4PRHB 2YRPA 2EEBA 2HKFH 4HS6B 4IM8A 4DGVL 3P73B 3B2UD 1VFAB 3GSNB 2HA1A 1LK3L 5HDBE 2J1KA 3JV0A 2WSKA 3WL9B 5A1AA 4L5FL 3KPOA 5H94A 3T8XB 1F4WL 4UTAH 1FGNH 4XMLH 2DMCA 1E4KA 1NBVH 3ARFA 1FYTE 3MMEA 5FF6A 3LKNA 1GC1C 3DARA 4C58B 4PJAF 1U6AL 3CC5A 3F7YA 3U2SA 2BJML 1E4WL 2YC1B 2ERJC 3I02B 4K8RH 3H7BA 4KKNA 4GG6F 1FNGA 2IJ0C 3S3SA 3VXRD 1Q9WB 3BSZL 1TITA 5HHQB 4BFIA 2D4FA 2VL5A 4NQEB 1Y6MR 5DJXA 5IVZB 2IGFH 4M1CD 4W4NA 5H35A 5HYIA 1IC1A 3O45A 4Y1AB 4D0DB 3LKPA 1D3CA 2A83B 2QEJA 4P2RD 1LEGB 3SKMB 4R6UA 1K4CB 1BQUA 4JFEB 2P5WE 1EDQA 2CGRH 2W9DL 4ZAKA 3V6OE 4EIZC 1VEOA 1HQ4A 3QXTA 1UVQA 4H1LA 2GY5A 4DFIA 3VD5A 3VXUD 3V4VH 3P11H 2IMMA 4YBQD 1MVUA 4RFEB 5D7KE 3IFLL 3ZE0F 3BWAA 5KVEL 4C83B 2HJLA 4TN9A 5B3JF 2D03H 5F1IB 3ARED 3GB7B 3UYPA 3Q0HA 1D7FA 4FXGB 4N9OB 1CGYA 2BFVL 4LHJB 4P2OC 2COQA 3L95B 3UTTB 4EBQL 3UO1H 3LRHA 3W39A 5E1AB 3MSPA 3NIFE 3I3BA 2EIZB 3THML 4F7EA 4X9BA 1DP0A 4OZGE 3WEXA 3MREB 4U1KA 4QF1B 4S10A 1FYTB 3D3VB 5E08L 3MFFA 5B38A 5FM4A 5IT2H 5T5NG 2Q7YB 4G8GA 2L7JA 3GMQA 3MLRH 3NFPA 1MWAB 5D7IB 2WBKA 5HXMA 2UZIL 3GBNH 2R0WL 4Y4KA 3OPZL 1T20B 4QTIL 1FJ1A 3JBG7 4MAYA 2IQ9L 3REWB 3QDMA 1FIEA 1U92B 4HG4J 2D7NA 3T8XA 1I1AB 2OR8A 1FQ9C 3ZTJH 4XVSH 5J6HB 4JO3L 2PYFB 2C26A 2VAJA 2APBA 3HRZB 1A5FH 4X6CA 4NO5A 3KJ4B 1AQDB 4KUZL 5IMMA 3MLYL 1WUNT 3L5XL 5D7JB 3HZKA 4FQCH 4NO2A 2DDQL 2CDFB 3H9YA 1Q9KA 5FUZL 5GS1A 1IC5H 1R3KB 1FAIH 3DPBA 1C7SA 2AQ3A 4U1NA 1PLGH 2X2YA 4WO4C 4M3JA 5C07E 3WNMA 1P4BH 4GG6E 3RL2B 2B39A 2JELL 1JGLL 4LPUA 4B7IA 3BESR 5GRUL 3FOMA 3PHQB 4UAOB 1RQ5A 1ZKAA 4JO1H 4FMFA 4OCRH 5SWSE 1JHLH 1T80A 2I26N 4ZXBC 4PGEB 3KXFA 4JPVL 1RZJL 4NRYB 4G7VH 2IH1B 4JFFA 3SGDI 4QO1A 4FNLH 4NOFA 1YEKL 3O6FC 4JHAL 4W6YB 3UJJH 5IQ7L 2F15A 5TQ0L 2NXYC 1A64A 4WDIB 1D5BA 3D1MC 2BY2A 3HUJA 5L9DH 1T7YA 4R0LC 1FG9C 4NN5B 3BEWB 3NCMA 3O6KL 4YPGB 3BO8B 1CLCA 2KQNA 2NY2D 3KDMA 2VOTA 1KIRA 3OHXA 1P9MA 2XZAL 3EBAA 4WHTB 1SBBA 5HHMD 1XF3B 1QZ1A 1HILA 4U7SA 4AEEA 4WEUD 4OZFH 1L9MA 43CAA 5DMGD 2AXHA 3RPIA 3QRFM 3QXDA 3GM8A 5I74B 5F7KC 1WFOA 2FDBP 1L0QA 3MRGA 1EO5A 5EBMA 1JGVL 2R8SL 1VFOA 4MVBD 4XH2A 3O8XB 1ZWIB 2HJKA 3MA9L 3RGVA 3RVVC 3BZDA 1LK2A 3GI9H 1RU9L 1YNLH 2KKQA 4I48B 5TF1L 2VLKB 5I9QB 4FABL 4P46D 3K1DA 5D96C 4F7CB 4I5BB 1HE7A 1U58A 3S36L 5BZDB 4N0FB 3PGDB 1AXIB 1JZ8A 3DURB 4F15B 3MUY1 5GSVB 5C08A 2R9HD 4JANA 2IQAA 2XFXB 2DICA 3T0EA 1UB5A 4V1DB 3V95A 4LQFH 2DM7A 1KENH 1FIGH 2AV7A 1I8KB 2XT1B 3QEGL 4XCYA 5I75B 1IQWH 3S96B 3LHPH 4TSAH 4NKIL 3A6BH 1NAMB 2VLRE 4K3DH 5DS8A 5C0FB 1O5DT 3MOBH 5IUSA 5E2TH 1HEZB 5FA3B 4UU9B 1FL5B 4U4BA 4HIEA 3NZHL 1T21A 4HF5L 4HBCL 5JW4N 2EO9A 3TJEH 2B8OT 2O61B 4TRPH 2Q8BH 4EI5B 4L3CA 1I4FA 4PJHB 4UOW0 5HD8C 2JE8A 1A2YA 1ED3B 3P4LA 5BV7B 5HHOD 1MY5A 1SY6A 3FB8A 5GS0L 3OKEB 3PDOB 1MELA 5JOFA 1RY7B 3MXWL 4LQ1A 2V9QA 1U6AH 4PJCB 4AYFA 2F8OA 4HS8H 3UZQA 2P24B 3V5KB 2R2CA 1U8KA 3MRHB 4NO3B 1S5HA 1G6RA 4P49A 4MCZA 4TULL 1IRAY 1NFDE 4WFGE 3C60D 3TIEA 4YEFA 4IRSB 3EOTH 5FUZH 2J7LA 3HUJB 1XF2B 5CIPH 3STLB 5BRZB 1E4KC 2GTZA 3KWWA 4JRWA 2HH0H 3VFTA 4F9LA 3TNMB 4X98B 1JRHL 1EO8H 2BHYA 2FRGP 4WO4B 4ENED 4IMKC 1OB1A 4N0CC 4L3EB 1LP9A 4XXCA 4PRPE 1HKFA 3FO2B 3EYSH 4C56B 5TE6L 3C08L 1FZJB 3L7EB 3MV7A 3V2AR 1EERB 3JWOH 3CZFA 4Q74A 5C2UB 2GK0B 2QR0B 4OT1H 3BX7C 3MCKB 2VZUA 4TSAL 2YSSA 4N9GA 1FVCA 5GGSY 4YHKL 5E8DH 3O81A 3VRLF 3TC9A 2VE6B 1QSFE 4I9WD 2J8UA 3SKJL 4Y4KB 5FYLH 2CKBL 1DLFL 1KB9K 3RVTD 2D0GA 4YIQB 5TE7L 2WUCL 3SCMC 1MAJA 3QIWC 4LVOC 3L6FB 1NSNL 3WN5A 2Q8AL 4FQLH 2NY3C 5E1AA 2VABB 3PWPB 3REVA 1KV3A 4MXVE 4N8CL 3O6LH 5DJ8A 2C3XA 2WWMD 1HH9B 1NGQH 3EO1A 1FO0B 3QI9D 2FJFB 1VB9A 1T5WA 4RAVA 2RAMA 5FGCB 2BDNH 5ILTH 5E7FA 4NQCB 5ACZB 4ONGH 1C8PA 3WYRA 3S97C 2DI7A 1D9KC 2ZWLT 5GS1B 1BD2A 1B0RA 2F53A 4P4KD 2X1PA 3ARWA 2M1KA 5IESL 1AGFA 3V5DB 3L3DA 5KVDL 5D1QB 2AV1A 1BLNB 2JB6B 3WJLA 4PY7B 3VDAA 3EW3B 1P7KB 3L3HB 4MXWL 5CEZL 1MCLA 5C6TH 3QHZL 4MAUL 4Y88A 1S9VA 1XR9B 1JGDB 1YUHA 2Q76A 1U3HB 2HTKD 4OF7A 3TNNA 5FUOH 3ZO0A 5BMFL 5FYLD 1F45A 1KTLB 4HAFA 4E41D 4YFEA 4JFDA 1U95A 4MGXA 3SDAD 4HWBL 3CVIH 4CMMB 1ZHLA 4OLXL 2BNRA 4Q6IA 5HYQA 4QRTB 1DQQA 4UT9H 2RJMA 4BFEA 1ACZA 5D2LB 3I2CH 4NQEA 2XQBL 2AKRA 5L6YH 4X6DE 4Z7UB 4LNVA 4YLQT 5FO7B 1DEDA 3U2SB 4KK6C 2YD2A 5DD1H 3WFBL 3I02A 3BPOC 3RTQB 3MV11 4TVSa 3I6GA 4NQED 3LQAH 3EOAA 5F7YC 3FQWB 1W0YT 4OGXH 4U1JA 1JPGB 4F3FB 4X9GA 3EYQD 3PL6D 5HYEA 3BT2H 2NTFB 4UT7L 1WICA 3S4SG 1ODAA 4QHLA 4JFEA 3JSSA 2VN7A 2EXWD 1SHMA 4HUWB 3B9EA 4LFHD 5I1DB 1FZMB 1T1ZB 4A6YH 1S78D 43C9A 2HN7A 5KSAD 4Y8AA 1Z9SA 1HYSD 4LLWA 3H6JA 3B83A 3S88L 2E6PA 3ZDXE 1Y18A 4OGAC 2X4PA 1CGTA 4F57H 3OR7B 5D1ZC 5IF0A 2Z92B 3WS3A 5E08H 2X4QA 1MJ7H 2Y6SD 2XNAB 3OKOB 4KHTH 1LGVA 4OB5L 4NKDB 4ZO6A 3QEHB 5MEND 4LGRB 4HKBB 4BSJA 1XGUA 2W91A 4LVNC 3NABL 5E8NA 3IDUA 3MROA 4NJAL 1KIPA 2C1OB 5FYJU 1FE8L 4NP4L 3N1QC 5BJTA 4PJXF 4KPHL 3QNZB 5IVXB 3NCBB 5IBUG 4RGNE 4GAGL 1YEJH 1F6AB 1N4XL 1MWAA 3BUTA 4V2BA 4EVNA 3OJMB 4U1HA 2CRYA 2GY7B 3SJVD 1JF5A 1WTLA 3D9AL 4PJDE 3CK0L 3DO7A 4XI5C 3HB3D 3RUGE 2P8MB 4YQXL 4Q6IB 3UC0L 4CL7A 4NNYB 4NRYA 1QVOB 5B22A 4U2ZA 5C08D 5ERWA 1I75A 3BZFA 3U0WH 2WK2A 2FH6A 1GGCL 1KC5L 2ATPB 1PYWA 4RBPK 5C07D 3NA9H 3SDDD 3TBYA 1J1PL 3IXAB 3ARBD 1A14H 5IM7A 1NCTA 1KN2H 4FTVB 3W11D 1QFPA 4D3CH 5DEFB 5J4MA 3L3JA 4F3FA 3MLPA 3ILPB 2ITDB 1PG7L 1MCWM 5LGJB 3BPLC 3UCRA 1QO3B 4KY1H 4QXGL 1JHLL 4QRUA 5F71A 3S37H 1I3GL 3V5HA 1CD0A 5HGDA 5K93A 4I18C 1P7QA 5I8EB 4HSQA 1G9MC 4HX1A 2CLZA 3QEQD 1H3UA 3E6HB 1NMBH 4BKLA 1MJJB 1Q9OA 1Z9OA 3IDMB 4HQQL 1FHGA 5DI8A 2E7BA 2E27H 1NCCL 5FK9A 1N3NB 3RVUC 4LRNH 4KKCD 3OQ3B 5C0EA 5EBGA 4IRZH 1E4XI 5HYFA 2MWCA 1YPZB 5DHYA 3GB7A 5BS0D 1PBYA 4BQ6A 1BEYL 2R15A 3O4LD 4CRPA 1IAIL 1LDSA 2H2PD 4BZ1L 1NEUA 5FKAB 4JFOA 1SVCP 4F2MA 2OYPA 1FO0A 5C8JA 2EDOA 1QACA 4LLAA 1JI2A 1FIGL 5ACZA 2VR9A 2CXGA 3GMMB 5JUEH 4NFDA 1JP5A 3BH9A 2XN9B 5CJXC 3X11B 4Z7WF 2GHWB 2R1YB 4JEGB 8CGTA 4H20L 3HZYB 4M4PA 35C8H 3ULSB 3L3HA 3Q6FB 1AO7B 2FO1A 4NNYA 4NYLB 4KDTC 5ITBH 4OB5H 3G6AB 5ETUB 5GGSB 4BZ2L 2NZ9C 4AT6B 2XXCB 5C0BE 4GRWH 4Z18A 1B4RA 1QHOA 4I77H 1HCVA 4HIJA 3VFNB 1BZ9A 4KI5F 5EU3A 3GO1H 3NN8B 4JB9L 4XXCC 3BRFA 3NZ8A 4KDTA 5E8PB 4LCWD 4LPVA 3FT3B 3BE1L 3ULUL 1N0XH 4G9FE 5I8KL 1QSVA 2JJSA 2DD8H 3LDBC 1EHNA 1S7RA 4H25A 3RQ3A 5I1EH 5I0ZA 4X99A 1MF2H 2PCPB 4YXKH 2B0SH 3R06B 4OIIL 4PJ5B 4OGAD 1IC7L 5C09E 5JA9A 2DJUA 4UQ2A 3T0XA 4H1LG 3TV3L 1QSEE 3RX7A 4HGKC 3GJFK 4MA8L 4M43L 2CIKB 3HMXL 4PJ8C 5JLZA 4JLRB 4P5MA 1NLBH 5IFHL 5CSZA 1LDPH 4N0UE 5T3ZE 1WIUA 2OL3B 3W2DH 1T6VN 4K7PY 1B9ZA 5DQDL 3VD4A 4LSSH 3MODH 5HDLA 3TIEB 4C55A 2A73B 1BX2B 3IB4A 2BY1A 1I8LA 3MC0A 5T3ZH 1T1ZA 2KDGA 1XR8A 3T0VA 3P9MB 4GLRI 4P5TC 4PJGA 5I1JH 4FQ1H 1RZ7H 5FKPA 2ENYA 5I6XC 4KJQD 4J1UB 4P5KB 2EH7L 2PW1B 5TGBB 2Z92A 1J9CT 1KBGH 4E41E 3VFUB 2A77H 3EO1B 4AM0B 3ZYIA 5J12C 5GIRA 1VFBA 3LPFA 5AAWA 3WUZA 4RMTA 3O6MH 5F9WB 3S88H 3UTSD 4OQTA 3MRKA 4U49A 4L8SA 3QIUA 3BPCB 3L6FA 5D1QA 2YXMA 1NH6A 3X12B 1R5WB 1YJDC 2R23A 2YXFA 3GBNL 1IC4L 5IIEA 5JHDE 1B3JA 3LV3B 1RHHB 1JRHH 4P0DA 4XP9H 4CN1A 3ULVH 2HVKB 4HLJA 1J87A 2DQEH 4HGMA 1ZHBA 5ISZE 5E03A 4YXHH 1JMZA 3BHBB 3KPLA 4GG8B 1MJUH 3UEZA 2J6EH 1DUZB 4P2YA 3MOAH 3PWNA 1B0RB 1FFNA 4P9HL 4KI5E 3B9KA 1WITA 5E9DA 3S35X 1CF8H 1L6XA 1OT1A 4OQTH 3TO4B 4PJHE 5GZOD 4YO0A 3BP5A 1V7MH 1W0WB 2EDRA 4JPWL 3RDTB 1T66D 4IMLB 3MODL 5D7LE 5F8RC 1M7DB 4QRSB 3ZHDA 2LFGA 5K59E 1QSFD 1CGSH 3F7VA 5EUKB 5FYKD 3MBEA 4UIMB 3U6RB 1XR9A 3NGBC 5I15L 4X9IA 3BYTA 2AJZB 4KROC 4PGBB 5T5FH 4E41B 5IWLA 1MQKL 2E8ZA 4YDIL 4MB5A 4M62L 4HKXB 5D7SH 3DX8B 4DKFL 3GMLA 2DQIH 3RWDB 2HFEB 4IRJA 2YD9A 5KS9E 1NL0H 3IFOB 4GBXA 3WO3B 4R4ND 3OB0H 2WM0A 5AEAA 3V52H 3L3OB 1S7TA 4CJ0A 3WNKA 5ID0B 2VXUH 4BH8A 1CQKA 2SEBA 3AS0A 2ED8A 4I0PC 3KXFD 5HYSB 5ILTL 4PYGA 3KLHD 4D8PB 4P9HH 4F15C 3BKJL 4U0RC 1F97A 3FAXA 4LDLB 5DQJA 1BM3H 4X7DC 4KKLC 4HJJH 4EOWL 4PD4K 1JNJA 2WV3A 2M8XA 5DR5L 1D5XB 1CGXA 4HJ0D 4OZFB 1X5LA 2ADIB 7FABH 5ID1B 3KLHC 4QGYA 4B50A 4M61A 3RZCD 3VGAB 3W0WA 3S8WA 4HUXA 4UILH 4G42A 4X6FA 1TZHA 1UM5L 4WTZG 2VDKH 4KJWC 3R0MA 1NGZA 5E1HB 5IW3A 5HHOB 2I9TB 1YEHL 1UJ3B 2BX5A 1NC4A 3EYUH 3Q6FA 4WTZA 4YXLH 1OP3K 3LPGA 4D0BB 2I60H 4L4TB 4NO0B 3DUUA 1FFNB 1SVZA 4LCIH 1IQWL 4JHAH 3G6JE 5T1LB 3UJJL 3UPAA 4AY0A 4Z7OE 1FZKB 3ZSTA 2G2RB 1AD9B 2N7BA 4KGLA 4S1SL 4OCNC 3T65A 1G7JB 4EDWL 2OL3L 2FECL 4O58L 2DQGL 4GXUM 2J5LB 1HQRB 5DJCB 3U36A 1NKOA 2XQYK 5FYKU 3IDXL 2WBJC 4JO4H 1KXVC 2KZWA 5C0ND 3U1SL 3HZVA 4D9RE 5EUKA 2C4FT 2NX5D 5JW3H 3DX9A 4L4VE 2X1WL 4R4FL 1P4LA 3N9GH 1AC6A 3QO0A 5F7EH 3TVMD 25C8L 3H9SA 1QKZH 1FC1A 4PJAE 3TP4A 1BMGA 5IKCA 1I7TA 4PJFB 3BKML 4NHUB 2O5ZL 5E2VL 4ZUVB 3VMNA 3JVGC 5DWUH 4MA3A 3OGCB 1AGEA 5CJ8A 5I1CL 4XMKL 4F7MB 3OMZA 2A73A 4KKCC 4RFEA 5T3XL 4D0CA 2A83A 1OAQH 3V5HB 4R96A 5F89A 2EDKA 5T33L 3MRNB 4P57A 2P5EB 5DJ2A 2GFBA 3BKCH 4JQXC 5CSZB 1GSMA 2EE2A 4PJBB 2CIIA 4BKLB 2IFFH 3KNBB 1BX2A 4ZXBA 3NH7L 3WBDA 4JZOA 5CKGA 5IHUL 3UJIH 1T7XA 3MLZH 1ZGLA 5B39A 3MZTA 1DL7L 1I1FA 4FTVE 4YUEL 3LB6C 1ADQA 1YPZA 1H3PH 1GAFL 3QUKB 4RQQA 5LGHL 4BJLA 5B39G 3GBML 3U30C 3RWCA 1H9VA 4JFEE 1EFXD 1HWHB 3P0YL 1UFUA 3P0YH 3WHE1 2M2DA 5D7JA 1RURL 4FZ8L 4OM0H 3IAPA 3EFDH 4X7SH 2CDFA 3WKML 1AGCB 4CNIB 2VDMH 2NY3B 1EEYA 1S9XB 5CJ5A 1RULH 3U7WL 1VKXB 3U82B 4HV8B 3O6FB 2IPTL 4G6FB 3AY4C 1F90H 1KSRA 3GMMA 2ITCB 4HMDA 1NMBL 2L0DA 3LKQB 1LE9A 3OBAA 5I1CH 4X4YA 3O0RH 2W92A 1JV5B 2GW5A 3VFNA 3OKNB 1PKQE 3ULSA 1BM3L 1QHPA 3B5TA 3VXUA 5ADPL 2ICWB 5IW1B 4L9LA 4NYLA 3ARFB 1UADC 4PB0L 5BS0E 3BPNC 3LQAL 3CFIC 4ZG1A 5I2IB 3KS0J 1VGKA 4P3WA 1L0YA 4MQ7B 3TLRA 4DUVA 1FDLH 3LEYH 2ZKHL 3D2UA 4HAGA 4HS6A 5IVXE 3CCHB 4OCYL 1QLFB 4X7FC 3U1SH 3DRQA 4UTBH 4MLIA 4BFIB 3CFDA 3U46A 5JW5B 4Y1AD 3C9NA 3L3JB 5D2LF 3SDAA 2AXFA 3VFRA 3RAJH 1ERNA 4HZLB 5A2FA 4F9LC 2YPLD 1KPUA 3HR5A 4PRIE 5JOEA 4NN6C 1K4CA 1OOAA 1IKFL 2P8LB 1OD9A 1K6QH 5BVPL 2EC9U 3LEYL 4I2XA 5DHXB 5E95B 1CGSL 3MRIB 4H1LB 2G75A 2X10A 4HPYH 3MLUL 4RA0C 4X6BA 2PYEE 5K9OB 3T4AB 3CZJA 5DI8B 5I1GH 2UZIH 4HWNA 3BMWA 1YY8A 2UUDH 2HKHL 3ARFC 1HIMH 1CLOL 1KTKE 3L3GA 1IM9B 5JO5A 3MV9B 4Q2ZB 1FH5H 3VFPA 1IAIM 3DUUB 4FABH 5FYJL 5ID1A 4R2GB 2WWKT 3MV7E 3MUHL 4OKDA 2F5AL 2HTKC 2FHFA 3HG1E 3M45A 4GXVH 4R8WL 5BV7H 5D6CA 4U05A 3TA3B 3U4BL 2ITCA 3LD8C 3HFML 5CD3B 4PRHA 4ZS7H 3IU3A 4RFOH 2DQCL 2VZOA 5F9OH 4DVRH 1RZKH 1JV5A 1D5ZA 4Y5YA 1JYWA 3SQOL 4MD0B 3ECBB 4GT7A 2X1QA 1D9KD 2HFTA 3LQZB 3LIZL 3ULVC 4NQSB 3QCTH 2FR4A 4D0BA 3IRZA 1A6TA 2ZSWB 5DJ0B 1BZ7A 3IXTB 4RMWA 2XY1A 3TBVA 4HK0A 3GMNA 1UKQA 4OFYA 3O9WA 3WJLC 3RGVD 1T83A 3FMGL 4S0TD 4HKXA 1I9IL 3F7YB 5ISZA 1U8MA 4LLYB 4WEBH 1N0LA 3DROA 1OGTB 4JVPA 3RVTC 3L7FB 3SHSA 5CGTA 4GQ9H 3QWRD 4K71B 4I18B 5E24E 1ZLSH 1ZLSL 4YO0B 1BPVA 3HE7C 1X4YA 5GZNC 2DMBA 4IRSA 1MCOL 3L7EA 4TULH 3DSFL 5EBLB 5DJYA 1N5YL 1BFOA 2FYYA 4GXUN 3SE8L 3MXVH 1IC5L 4PJ9D 2GFBB 3Q2CA 2E5EA 5T3XH 2VZ3A 3SGKC 1MRDL 2FBJH 2DLTA 4L8BB 4G80B 1I8IB 4N9GB 4X98A 4I4WB 2YWYA 3KNBA 1XH3A 5C6TL 4P2OA 4JVWA 1M1SA 1AGBA 2K7PA 3T0EE 1X6NA 4I0CC 4IRJB 4Z8FL 1NGZB 1WZMA 3UPRB 4L29B 3MJ8A 4WFEE 4KI1A 4DKEL 3IFPB 3DXAB 1DDHB 3U4EA 3OWEA 4GXVL 4R8WH 1DBBH 5BV7L 3BRGC 4QY8A 4G9FD 5IT2L 1KCRH 5CD5D 3DV6A 4LIQL 2VLKD 5I71C 4N0YH 4XVUC 4ODVH 4LKXB 4NQCA 4O58H 2MQ3A 4K55A 2CRIA 5LCVL 1IMHC 2F53B 2EDBA 3BI9X 2XTJD 3HE7B 5GRZA 2VJXA 1I8KA 3QO1A 2WANA 4LCWB 2MPAL 1DBAL 3JWDC 1DVFA 3DURA 3MQIA 5I1AA 2HFGH 4OUUB 4R7DB 5KN5A 1V7NL 3VRJA 5IB5A 1R0AL 3O4LA 4MDIB 2XKSA 1RPQA 2AJXL 1FL5A 3ALXA 5J13C 2VDML 1WLHA 4XH2B 2Q76B 4WW2C 5GHWL 4OD2A 3BGFC 5DQ9A 2BNUA 3BVNA 3DVNB 1W72L 2HVKA 4F9PC 5HVHC 4QRPA 1BOYA 2DAVA 1T0PB 3HAEA 5DD6A 3STBA 1JF1A 1TJHL 3B2VL 2MPAH 4IRJC 3VE0B 3EYSL 2R2EA 1F58H 1NDGB 2PKDA 4NBZB 2XPGA 3QUMH 5EFIB 4F58H 3GUTA 2EYTA 2HT2D 1OAYH 3WFZA 1MLCB 4V1DE 4WWKB 4KVNL 1HQRA 3F58H 5DJCA 3U36B 3TWCH 2AV7B 3O8XC 4DWHA 1U3HA 1KCRL 3LN9A 5TQ0H 4IMLA 3PDOA 2NX5B 3BT2L 1MNUH 1OCWL 2VLJD 4X9HA 4G7VL 3LDBB 1XF2A 3FTGA 1AD0B 3QULB 1T4KB 4U6XB 3PNWB 2WIIB 1U3JA 4Z8FH 4JFHE 2IH1A 1JWSA 1MHEB 4NO3A 1D6VH 4NRXB 1X5ZA 2P47B 3WDIA 4YHNB 5MEPB 4WW2F 1LEIB 2VXQH 4JAMA 3QIWD 1SBSL 2X4NA 5GS0H 4OM1H 3TESA 5HI3C 3OKEA 4ELMA 2NY2C 1VGEL 5LAXB 3G5XB 5J12B 2HYMA 1KTDA 5FO9A 2VLKE 1CBVH 3TN0A 1F3JA 4R97B 3TJEL 4DOHB 2P24A 1TPXB 4PRNA 3FO2A 5BZWB 1HH6B 2RCSH 4P5TB 3L5JA 3IU4H 3EYVA 1H8SA 4FS0A 4QXWA 3BKYL 2YUXA 3TN0D 1G7QA 2VE6A 5E2UH 1QNZH 3RIAK 5CGYD 3J7HA 2GK0A 4OQTL 35C8L 2VQ1A 2HFGL 3IDJB 3QAZC 3L5HA 4OGYL 1IGJA 4NKQB 1JNLL 3G5ZB 2ZUUA 5F70A 2RFXB 1LO2L 4P23D 1RUAL 2OLDA 1ZLWK 4ENEC 4CMHB 3CFJA 1AXSA 4Y4KD 2VDRH 3PWVB 2XA8H 1S8DB 2XA8L 1KJVB 2JLLA 2FH8A 3MA7A 1JYNA 2QSTA 2E27L 2YMXL 4U1LA 4KK9D 1J1XH 3L5XH 5F7LB 1N6UA 4PP1C 2X5PA 3C60C 1JF1B 1HDMB 2R4SL 3DX6A 3V7AG 1HXMA 2R2EB 1KGCD 5T3XE 5C0CD 1CLOH 5IJVA 1IBGH 5C09A 2VC2L 3QDGB 4HCRH 2ZCKH 1BF2A 2DS4A 1MHHA 4KAQH 1IJ9A 5AD0A 1WBYA 5HI4C 4OFVA 1DN0A 4LHUA 4L9DA 1RIUL 3WO4C 5TFSH 4Z7QE 5HDQL 3DMMD 1RFDL 1P2CB 3QPXL 1YECL 3HI5L 3K1KC 4ZPTA 2Q86B 4OV5B 3MACH 4J3SA 3QUMA 4J8RB 4J3WA 4PG9B 5E70A 5C0BA 3RA7L 3S34H 4CAGA 4FG6D 1I9EA 1BFOB 3PJSA 5K59F 2N1KA 4GAJL 1NLDL 1DQLL 4JFQB 4YGVA 3QG6B 2ZOLB 4P59L 1MJJA 1Q9OB 1KN2L 2H2SC 1N59B 3CFDB 4ODHL 4I18A 1NEZG 4PLKC 3TWCL 3WD5L 3MRCB 4TUKH 1UWGH 1BQLH 5E8EA 4QRUB 4JHWH 3IAGC 1UCTA 5DLMH 1MCHA 5B8CC 4OFIA 3U0WL 3S34L 5TE4H 3OR6A 3WNLA 2DWEA 4Z95H 1ZOXA 4S1DD 1FPTL 3T1FA 4HWBH 4YDJA 3Q6GH 3QRGH 5ISZD 2OXHA 1T2XA 4FFVC 1EXUA 5FYKE 1IEHA 2DQEL 4Z7VE 1WBZA 2ZNWA 1RZIB 2AABH 4HWZA 1QYGH 1TIUA 4KH2A 1DFBL 2Y5EA 5DJDA 1KELL 4LKXA 4MAUH 3D69B 5DA0B 3GGWA 1XIWD 1KN4H 3EYUL 1ZVSB 4YXLL 2BVYA 5IB4B 2YPKB 2DTMH 3FFCB 1OSZA 4M5ZL 4TQEH 5JO5B 4RNRB 4JREB 3MOQA 1MLBB 1NMCB 3GHEH 5J06A 4WI6A 5J6GA 1TZIB 4AT6A 4W4OA 3GHBH 3MV9D 1KEMH 4P3CL 4Y1AE 4HUWA 2A9ML 5CJOH 3W0WD 5DD6B 2H1PH 3B6SA 1PKQA 3MX0A 2E7MA 1BBDL 4TQEL 4YFDB 5TE4L 5C0IB 1LO2H 2HT2C 2H32A 2YOCA 1GCFA 2GJZA 3BOVA 1D5ZB 2ZCLL 4PJGF 2HT4C 3VFWA 3ARDA 3MNVA 4WO4D 4CMHC 2CK2A 5DK3A 5I17B 1KFAH 1BZ7B 4WI8A 1S9KC 2YZ8A 4HK0B 3TEUA 3ARDD 4NWTL 3O9WB 1NCBH 4XC3H 4XPGH 1KBGL 3ECBA 3H7LA 1BIIA 5I1LB 4PS4H 1PD6A 3TBYB 4LRNL 2P7TB 1U8JB 3ME0A 5AYUL 1GGTA 1JHKL 4LLYA 4PJDA 5HHMB 3DMMC 1ZHLB 2BMKA 1QTYT 5IEKB 5FUOL 4NKMA 3GSQA 3BAEH 5DHVB 3SKNB 5HI4D 5H35B 2UZXB 4JY4A 4EUPG 3KPQA 3FB7B 2XQBH 3IDGB 1I85A 1CZ8H 3ULUF 5IM7B 5JPMB 4YDVB 2EDTA 4JPVH 1FCCA 4KQ3L 3TH2T 2UUDK 4LFHG 3VXSE 4XP5L 2XI9A 1JPGA 3S3JA 4UT6H 4TOYH 3VD9A 1JFQL 1UB6A 2GUOA 4UNVA 3CMGA 1I8IA 4JZNB 3WLBA 1EFXB 1T04A 4KK9C 1LMKA 5FECB 1CU4H 5ESQA 1N3NA 5IROC 2P8LA 3IETB 5T1MB 1MF2L 3C6LD 5I1DA 1HHKB 5I8EA 1FNGB 4LSQH 4U1MA 1NBYA 3IDXH 3JXAA 3CVHH 1JPSH 3QFDA 4HX1B 4DGVH 5DEFA 4X5XB 3GSWB 3PWVA 1LP9E 3K4AA 3KYMB 2MHAA 4NJ9L 3UMTA 5F1SA 2HRLA 2IAMB 1RMFH 1QKZL 4XNXL 3KR3H 4J4PC 1C16A 3ZE0E 3DOSA 5E8DL 4QXTB 2DYPD 5B8CB 3N06B 5GS0D 3NFPB 1EK3A 1VADB 3FT4A 3U9PH 4YNYA 1E4XH 3SN6N 4DGYH 4PJEA 2Z8RA 2VQ1B 1KIPB 2C1OA 3V6OC 2CLRA 5DD5H 3FQXB 3HPLB 3STZA 1I9JH 1ZANH 1KIUA 4NP4H 5GGUA 1NCNA 4P46A 4LQFL 6FABL 1KJMA 1RZGB 5I1KL 4K3EL 3QCUH 5MHSE 2H26B 3OL2A 1HHIA 3L5IA 4HKZB 4OGYH 3GSOB 3WHXA 3WUWB 4EDXA 2LE9A 2FECI 3ARBA 1BIIB 4MS8C 4ZO9A 4WUUB 5C0AE 5CGMA 1U8OA 1U8JA 1KIQA 4TSBL 2YRLA 4LHQB 5TDOB 3ZKSD 1CD1B 4DAGH 3GSVA 3LH2L 4PJIE 5GGRB 1MCCA 1CXIA 1AQKL 1RJYA 4JM2A 3HC4L 1F4YL 4HPOH 3O8XD 2KL6A 3IDNA 1PYWB 5B3JE 3KYNB 1IAKA 3HCVB 4WW2B 4GUPA 2QHRL 4MMZC 3O11A 4XPFL 3SY0B 2VSCA 2APTA 3KPOB 5GRWA 5H94B 4MS8D 5A2JH 4Z0BH 5E8EB 2NY5L 1TETL 3DGGB 5C7XH 5JXED 1ACYH 3VWJB 5HY9B 1CIUA 1HCFX 1MJ8L 3HC4H 5GGVH 4JY6A 5H2BB 2VZSA 3WFBH 4XRCA 3SKOA 1GC1H 1SY6L 2UWEA 3FTGB 4UIKH 4H8WH 1IARB 2GAZB 3QIUD 1RUMH 3ABZA 2NY0C 3HE6B 1S7TB 1GPOH 1Q0XH 4G6JL 2BVTA 4HIXL 5GS0C 2J8UE 2VIRB 4PRAA 1FV1B 3V6BR 4KHXH 4WRLA 3VRIB 1CFNB 1G9NC 1YDPA 3P0VH 4JHZA 3VXPA 5T5FL 4RMRA 3QI9B 4APQA 1U8QA 1TJHH 3B2VH 2WBJB 3O2DA 5IGXL 1DCLA 3HUJE 1E0OB 4I5BA 1MFCH 4YQXH 5C0GA 3OXRB 3RBSA 1NFDB 3IDJA 2NY2B 4LOUD 1S3KH 5E00A 1XF5A 2OBGA 5KVGH 1J10A 2P45B 3QEGH 4RAHA 1SYSA 5F3HA 4AL8H 2BVUA 5IIEB 2APFA 4D9QE 3O2WL 4CVWA 3HHRB 3QZWA 3WXVH 1UZ8B 1A7RH 1RUQH 5CHNA 2NQCA 4JG0H 4NGHH 1DN0B 4XNZB 4TNWF 1XF3A 3VW3H 1NFDF 1JPSL 3RBGA 1AXSB 1KNOB 1NMAH 1MLBA 4N8CH 4UV4L 3BHBA 3BP4B 4PJ9C 4YDKL 1B0GB 1S8DA 1L4IA 5GGQL 1EJ6A 4O5LH 2MQCA 5L0QC 1FLRH 4PREB 5C09B 3DIFB 1YQVL 1PQZA 2EYRA 1FO0L 1G7JA 4KV5F 2BHZA 3G9AB 3K3QA 5C0AB 4WW2A 4PV8B 5F7HA 5B4MD 4PRHD 4M1DH 4YHZL 1BECA 1WZLA 2IQAB 3TO4D 4ELMF 3MRJB 3MNVB 4PJCA 2ARWA 4X6CE 2YPVL 3GI8L 4O51A 2IBGA 4Z78A 4HJGA 4LU5H 3UTPD 3EYOA 5L88L 1J5OH 2AGJH 2D0FA 1K6QL 2A74A 3FOMB 4O2FB 3SDXF 1TCRA 5DRZA 5BVPH 5C0BB 2FZ3A 3ARPA 1X5KA 3D0LB 2A1WL 1T1YB 4CDHA 3HMXH 3LEXA 4XRCB 2HRPH 3SKOB 4H0IA 4DK3A 4GW4A 1RI8A 3GMLB 4JQIH 2O5ZH 4P23C 4YBHA 2GTZB 3BRDA 3TV3H 1CG9B 1IC7H 4E41A 5BXFB 4HK3J 1YMME 3MLYH 1OB1B 3QWRA 1LP9B 3M1BA 2OK0L 3TN0C 5DJZA 2J4WL 5KS9F 5HGAB 3F5WB 1OPGL 4R96B 3EZ8A 3MV7B 1IAMA 1UM6H 4W68A 5ID0A 2A2QT 1KCKA 4R3SA 5EZOL 1N4XH 2HLFC 5KOVC 2R1WA 1SJEA 4PJBF 4QXUH 4GMSL 1J18A 1PKOA 4OJFH 4GAYA 3SGKA 2VXTL 1FL3A 1MRFH 1N2RA 5EORH 2EH8L 4NNXA 3DWTA 4P3CH 4PRIB 1FBIL 3B9KC 3BGAA 1PGRB 2F8VA 4X6EB 3F7QA 5J13B 2Q8AH 1KLGB 3FONB 1WC7A 3RNKB 5KZCB 3ZKMD 4UINL 1NBYB 3QPXH 3RKPA 4RSVA 3PV6B 3RWFB 1R24B 3MRBB 1F8TL 4M5YH 4XNYH 2WQRA 2CJUL 3OPZH 1U8IA 4ZPVA 5KS9A 3QXDB 4U6YA 3VRLE 3VXTA 3FQUA 3FT2A 2EECA 5EU7E 1YYLL 2Z91A 5KSAA 4OTXL 1KJ2A 4G9FA 5CEYA 4ODUB 3HZKB 4YNYB 1R0AH 1JRHI 5CLWA 4XC1H 2DIJA 4UU9A 1U91A 3KPLB 4LLVB 1A4KB 5DMKA 2VSDA 4GBXC 1QUNA 2IADB 2IPUK 1ZHKB 3BQUC 1B6UA 5CZVH 4WEMB 4RMVA 3MFFB 1ITBB 4EI5A 3WMSA 2V17L 1LVEA 1C12B 2WP3T 3RWIB 4H26B 1S9YB 3BP7B 1A4JA 3HMWL 4NZRL 1K3IA 3C8DA 4DQOL 3R1GL 4Q0XL 2D3VA 4WHYH 1KPVA 1M7DA 2JKXA 3MJ9A 2OK0H 5EOQH 5IMOB 4IBLT 4M43H 4JFZL 4YGAB 1IKFH 1OHQA 2KUTA 3RUGB 4POUB 4H5SB 5HY9A 4OZGB 4YHML 5D7SL 4XXDA 5FDWA 4H1LH 4WHCA 1EFXA 1T04B 4XHJC 2F19H 2DJ4A 4NQVB 4O2CB 1A1NB 1ORQB 4KJWD 4XVUD 5J56B 5CD5C 3QDME 3ZDYF 1U3HD 5BO1L 1CDGA 3NACH 3SY0A 1RIUH 5JQHC 5A3ID 3HN3A 4J3XA 1Q8MA 3U7YH 3G5VB 5DFWH 4ODTH 2V5YA 2Q8BL 4TRPL 5GGRY 4RRPG 4TUOB 1F11A 5EU6A 1DQDL 3WNOA 5FAAA 2DKMA 5DRWA 1DE4B 5FHBH 4NRZB 1X6LA 1N6QH 5A2LH 1KB5H 3I6LD 4Z5RB 3ES6A 4L3ED 1C5DB 2P46B 3KPRE 1U2HA 2AJSL 1ZEAL 4E0RB 4R97C 3QIWA 4DQOH 1B4JL 1J1XL 4LF3A 1E6JL 5JMRA 4UUJA 3GJFH 1OT2A 2VRAA 4JZJA 1I1FB 1HHIB 4S0SD 1P4IL 4N0UA 4U1JB 2D2OA 3ARBB 4MNHB 4YJZL 4KROD 4BZ1H 4Z76A 2P5EE 5E8NB 3KYMA 3SQOH 1UWEH 2XACC 1IEAB 3IXTA 3GMNB 4FHBD 2V2TA 4KK5D 3K8MA 1LO3H 4Z7WB 3T3PF 1QRNA 4XP6H 4ZXBB 1T3FA 4UNUA 5I66B 4NUGH 2OS7A 5GRJL 5DTFB 3WUWG 3QHTC 1BFVH 1XCQA 4AEIH 2HN7B 5KAQG 3GSOA 3F6IA 3IS1X 4GUPB 4Y5YB 1HSBB 4LSQL 5JPNB 5LCVH 2XQYG 3LSOB 3EGSA 3QQ9C 4PRHE 4BELD 3RWEB 1IFHH 4CW1B 1ORSA 4WENB 4XAKD 1OGAE 4ZO8A 1CQYA 5D4QA 2JF1A 1MJ7L 1MUJB 1UKSA 3TVMC 2ZUVA 4EUPA 3W9EA 1AE6L 4PG2A 2LVCA 3C5ZB 4UBDD 4L4VB 1SY6H 4UIKL 5FA4B 4LSDA 4OLYL 4L4JA 2ARJA 4H88H 5ICZB 3I84A 4Z77A 4B0MM 1BVKB 3RHWK 4LHUD 3V6ZA 1RUKH 3P9LB 4QT5A 2AVGA 1WAAE 5DHVA 3GK8L 2B0SL 4QHNA 4YXKL 5ESVA 4XMKH 1EFQA 4ZODA 3U0TA 3LKQA 1BJ1H 2V9TA 3MGTB 5KSBE 2G5BB 5DUMH 1A3QA 3DBXA 2E6QA 4QYOA 4A6YA 5IROA 3VFSB 2FHCA 1IM3A 4XPGL 3MRIA 1ES0B 1ZV5A 2CLZB 3DYPA 4PJEF 3HR5B 4X4XA 4C57C 4FTVD 5DD1L 1MCJA 4YWGL 1GHFL 2R4RL 1IGYB 1MFEL 3O4OB 3FHAA 1MVFA 1UZ6F 1EIBA 4AEHL 2QQLH 2ERJB 2NCMA 1J8HB 4KZEL 1MCPH 3D39E 3I3EA 4XHQA 1Z2KA 3TZVC 4LNRA 2AK1L 3CVIL 3SO5A 5IQ9A 5TPWL 3PWJA 4M7KL 3ZYJA 4GRWB 2A9MH 4OLYH 3ROLB 1K9TA 3K80A 5EOQL 1AY1L 1HNGA 1OCWH 1YEGH 2W60B 3AXLB 2IWGA 4MXQD 3NIFF 3K74B 2FJFA 4PRPB 4HKBA 4XBGB 4HFUH 3ALWA 5CJQH 5GJTL 3QDHA 4KVCL 4QOKE 4GLRH 3ZE1E 4BM7A 4FQLL 4JDVB 4ZS6D 1ZA6A 3VW3L 3A6CL 3VXMB 1G7HA 4YZFE 1BIHA 3DX7B 5D7LB 5JPNA 1A9BA 1DLFH 3S4SB 4DTGL 4H0GA 2Y5TA 1YN7B 2IANB 5BCAA 2GJJA 3EJYC 3GSNL 3QDAA 1HSAB 1U36A 5EC2B 3FQNA 1OAKL 5IF0B 4S1RH 3RIFF 2GQHA 4YR6A 3U0PA 1KXTB 3L3GB 3SBWA 2QV2A 4XCNA 5FA4A 1FRGH 3QJFA 5JR1L 3NOIA 5L2JB 5L2KB 4DZ8A 5DK2A 5IGXH 1NBQA 3BD5A 4JFPA 5GGTA 4MQXC 3TBVB 3I85A 4OZIA 1SEQL 3N85L 1F4XH 1A6AA 3X14A 3EHBC 3MLSL 5DO2C 3ARGA 4HWEL 2AI0L 2FX8H 4GMTH 3N50A 4ODWB 2VITA 5K9KB 3U48A 1BP3B 3LRSB 3WIHA 2GSIB 3HG1A 1C1EH 3UTSB 3QUXD 4AIXA 5FGBC 1LE5B 1AC0A 4QXUL 1GOGA 1JL8A 1J1PH 1DJSA 1F11B 2OJEB 1JWSB 3LB6D 4JRYE 1JI1A 1NBZA 4NNXB 2GSGA 3TA3C 4QHLB 5D7JC 3RAJL 1TETH 2CDEA 4IS6B 2EDYA 5D1XC 4NQVA 1DQML 3PV7A 1XZ0B 3E3QC 1OTUD 2EE6A 2A6JB 4RISH 4ZNEA 2V2XA 4GRWF 4YHYC 5ANMA 5JHLH 3ZLQC 3MR9A 3RY5A 3VXME 5AYQA 4NDMB 4QNPE 1T03H 4OI8A 4ZSOE 1MREL 2DN7A 1T7ZA 3T0WA 2X4TA 5EIIA 2A1WH 4KJYB 1TQCC 1KJ2B 2QADB 4I77L 1K8IA 4DAGL 2AGJL 3V79C 5FYKL 4GRLD 4ERSL 3NMEA 4MX7B 4KK8C 1NBVL 3VWKD 4ALAH 3UTZA 3HI1A 4LLVA 1QSEB 1FL3B 2VO5A 1NFDA 3UAJD 4XP9L 3W11C 2X4OA 4XZUA 3FOLA 3LAFA 4WU7B 4RDQG 3MA7B 1CICA 4L8DA 3QO1B 3H42H 3TT1L 2X4UB 4FN0A 4U1HB 3BDYH 3ZE2E 5MEOA 4LSVL 3LKOB 1DVFB 3BISA 2DTML 3PP3K 4G8IB 4RFNB 3KPPA 3HC0B 3QUMB 4F7TB 4JFDE 5DFVD 1IILE 3W2DL 3K2UL 2Z31A 4XI5D 2IADA 3U9UB 1QR1B 4PREA 1OSPH 2OXGA 4PGJA 1KENL 4PJ5E 5F6IC 5ESAA 5MEQB 1A1MA 3DYMA 1KB9J 1YZZA 3B5HA 2C7UA 1F42A 1Q0YH 2VITB 1JGUL 3TH3T 1MCBA 1GGUA 1XCTB 2VLRA 3QIUB 3CAFA 1TQBB 3RY4A 1OF2A 1PG7W 2VXQL 5LVEA 3UJIL 4UINH 5CS7A 1WFTA 3V0VB 3GBLA 3DHMA 5C08E 2QLVB 2JJTC 1TJGL 4G5ZH 5ELIA 1HIML 1JGVH 1A6VL 1F13A 4X7TB 3D0LA 3S37L 4G6MH 1INQB 1J05B 2QSCH 3EUUA 4DK6A 2XIDA 4JAMB 4ZUUA 5D1ZD 2NY4D 3CNKA 3UBXA 3ZHKA 3HMXA 1MHEA 5DJDB 1HYSC 4LLQA 1FGNL 4XMLL 1KPRB 2ORBL 3CFEB 5DFVC 4H8WL 1CIDA 1S78C 3GSXA 5HYSA 2OTWA 5FM5O 1TNNA 4NZUH 4OLVL 2X4NB 3DETC 3JUZA 1YEIH 1IT9L 1H3WM 2GJ6D 4ELMB 4AEIL 1JHKH 1AIFB 3TZVD 1I7RB 3PQYA 5DJAA 4KAQL 4P4KB 2CO7B 3S7GA 5JLZB 3IFPA 3UTTE 1I7UA 4K3DL 2WIIA 1CR9L 3O41B 3KG5A 3TZVA 3WXWH 4JFFE 3B43A 1MVUB 3DI3B 1GRWA 3VG9C 1U3ZA 3IFOA 4HFWA 4GRLC 1PLGL 3MV8B 4MJIB 3MNZB 3D39A 4IRZL 5E4EB 4APQD 1BBDH 5FOBB 4J1UA 2CKBH 5LJYH 5BQ7B 4FP8H 1NUGA 3O4LB 4F7EB 4N8VB 5AUMB 4ONFH 4XNZC 2DLEA 5LKNA 2B1AL 2X41A 3CSPA 1U58B 4NQDA 4V1DD 4PJ9B 2WBWB 2EIZA 4X4MA 5D1XD 4NZDA 3AB0C 4M61B 5D7JD 5EO0A 3QDMB 1I3GH 3ARBC 1NDGA 1R5WA 2WQ8A 3GZKA 4PIRF 5FDYA 1A3RH 2XKNB 4P4KC 1MLCA 3FN0H 3DV4B 4HG4K 4O9HH 1T22B 3QUYB 1J0YA 3P11L 4XNMA 5EUOB 4NN7C 4J6RL 2EC8A 2W0LA 2R0KH 1J05A 3SE8H 5L2KA 1OAUL 2JCCE 2PYED 2VH5L 4NM4H 1PZ5A 4XP1H 1P4IH 1C5BL 2O93L 4A2LA 1FZKA 1FC2D 4G8EA 3OKMA 4KQ4H 4X8JB 1YNTA 3UYRL 3T0ED 5DEGB 1INEH 4AJ0A 1E28B 3T04D 1NC2D 3GSXB 5KBNC 3CVHA 4OSUL 5ICXB 3NN8A 4FQXA 5FV2A 1CU4L 4FQIL 4IJ3B 3KDMB 5L6YL 4NFCA 2XZCL 3TVMB 4WHTA 5D1QC 1AIFA 1ETZB 4P9HC 4DKFH 4KJQC 1CYGA 2FGWH 2QQNH 3LN4A 4NPYB 4KQ4L 4GO6B 5EU5A 3WLBB 3LKNB 1T89C 5SWQA 1LEGA 2DLFL 5IR1B 1UXSB 3BZEB 5DQJB 1J0KA 1A1OB 3VFSA 1I7ZB 2AEWA 2JB5L 5FM8A 4O2EA 4ETQB 4WUUD 3BO8A 2FO4B 4A2MA 2P5WA 2V7NB 1TCMA 1G7HB 4MJIE 4OTXH 4QHUB 3DETD 3PP4H 4NC1E 5IQ9B 4XZUB 2SEBB 3VGGA 3RI5K 3DGCR 2DF3A 4NQTA 4XVJL 1HOCB 4LGSB 2B4CL 1CFBA 1BFSA 1MFAL 5AZEL 2EXWC 2OR9H 1G0DA 5D5ME 5JDJA 2VC2H 2DQUL 3U0PB 1QBBA 4I0PD 5DT1H 1QSZA 4JJ5A 2P8PA 4LL9A 3SE4C 3RWGB 3KXFE 4JDVA 1KCSL 5EO9A 4M4RA 1RZIA 3AMKA 1WCBB 5GRYA 4ONOA 3T3MF 3TBTB 2FATL 2IFGA 3S4SA 3SJVE 3WEXB 1A6AB 1UJ3C 5GGUB 1FYTA 4TNWK 3MRPB 1Q9LB 4WU7A 2C7UB 2EICA 3GKZA 1EH9A 5D71H 4GG6A 5EOTA 5CEXB 2RR3A 3QQNA 1H3VA 1UM6L 2NY0B 4LRIA 4KZEH 5HTSA 3S6CA 4P2QD 3KPPB 1UB5B 2F5BH 4Q9RL 4DGYL 1VFMA 2ICWA 3OJDA 4Z7NE 4PGCB 4NQCE 4KU1A 3MRQB 4LARL 4NC2B 1T66C 2Z4QA 4ZFOL 3OG4B 5FYJD 2PW2B 4QF1A 1PAMA 1A02N 4U1GB 1MCNA 5IB2B 1U8LA 1HHJA 4YFLI 4M48L 3KPQB 3VXSD 4PY8I 3ZT5A 4WVRA 5HYJB 5L8KB 4JM4L 4RRPA 2H32B 4P4RA 4URTB 2FCBA 1U92A 2UV3A 2H45A 4M1GH 3U46B 5JW5A 2XWJA 3B8SA 4XBPA 2W9EH 4KTYA 5IG7A 3HKFA 3GMPB 5T1KD 4Y19B 1RZJC 1QSFB 3LCYA 5ACLA 3LZFH 1HHHA 3FB7A 1KEGH 1OGAA 2ZUQB 3MGTA 2BSRB 1RK0A 5ITFA 3T1WA 2G5BA 2D4DA 5ESQB 2XN9D 3EYFA 3HS0B 2PXYA 1GZQA 1WEJL 2NY7L 1A7BA 1AHWB 1T03L 4QNPF 1T1XB 4G6AD 4AIZB 1A3LH 3E6FA 5I2IA 1U0QA 4JFXB 2GKIA 4X4XB 1T0MB 5JTWA 3WSQH 4EXPX 2A6JA 2NYYC 3HC3H 1KYOK 4NSKB 1QRNE 1AGDA 1ZGLP 5CZVL 1JPTL 3QFDB 5EU6D 4HEPG 3JWNC 5I15H 3QH3B 3P3YA 1HZHH 1WGOA 3IJSB 5DVNA 2AXFB 3VFRB 4G8FB 3C8KA 5IBTL 5TDNB 4MQTB 4KFZC 3JWOC 5H8DA 3B3IA 2W60A 3AXLA 3LEVL 5ACMA 2YSSB 1YYML 5T1LA 3DTXB 5T1DH 5HVGB 3OF6D 1BGXL 3KLAA 3I6KB 5I8OH 1J0IA 5FGSA 1UWEL 4R9HA 5I19L 5E5RB 3NFNA 2I5YL 4N0CD 5IP4A 3ALPA 3CFKA 4LPCA 1AGFB 3OAUL 4HMEA 1Z3GL 4WCYL 1RZ7L 4NQCD 2AV1B 3C5ZC 4NQSA 2QBWA 3FKUS 5IHUH 2IPKB 3SE4A 2X4PB 1JBJA 2ZSWA 5DJ0A 1TZHB 2VISA 5GISL 5A3IC 2NTSP 3FQNB 4TVPL 3DMMA 1NGWA 4JRYB 4UQ3A 3WCYA 1BREA 3MA9H 2XG4A 3MROB 3HLAA 5SX5K 1EMTL 3MV7D 4PRDA 5L2KE 1HHJB 1J1OH 3C08H 1CD1A 4UDUB 5DEGA 3RU8H 4LLDA 3A6CH 3TYFA 1DLHA 5M94B 3T2PA 4NFBA 2YA2A 1K2DB 1TTGA 1CFSA 1QA9B 2V5RA 2NZ9D 4TTDD 3BKYH 2XWBB 4XCEB 2PXYC 4M6ML 4LBEA 3IJYA 3L3IA 3Q48A 1K4DA 1XGTA 3TO2B 2Y6SC 1MRDH 2FBJL 2FJHB 4O00A 5F6IB 4ZS6C 5F89B 3ESUF 1EEUA 2AAVA 4JKPL 2R0ZL 4UI2A 3MLXH 5FHAH 4KC3B 2PN5A 4RCAA 2XZQL 1BVZA 3RL1B 3OKMB 5C3LD 4OCRL 2WUBL 4GBXD 4HXAL 4JO1L 3JZ7A 4BZ2H 5CP7B 5KG9A 2ICWI 3QQ3B 2VAAB 3WS6C 3R8BB 4HUVA 5D6DA 3SJVA 3D39B 1AR2A 3O2DL 5D7LD 1NLBL 2W65A 1S5IL 3C9NB 4YBLC 3WFDH 3WS6A 1NLDH 1HOCA 1UC6A 3D87B 2J2ZA 4X6DA 3T2OA 5KSAB 3MRHA 3RVVD 4ONHB 3TZVB 1MAML 2CQVA 4X6EA 5D70H 1QFWL 3HNSH 2NW3A 3VU2A 3CXHK 1CXHA 2BVPB 4CVZA 4ZUTA 4O2EB 1KCVL 1U91B 4Y8DC 3P30L 2GIYA 1I7UB 3QFJB 3LHPL 4HUMB 4MJIA 3MCKA 4IHOB 1N7ML 3MRBA 5I73B 1FVCB 2BSED 3S36X 4QTIH 3QYCA 2C1PB 1A3RL 2QJDA 2AK4D 5LGHH 4HK3N 1AQKH 1AE6H 1T22A 3QUYA 3MV8A 4W4OC 1FG2B 3OKOA 4G9FB 4HT1H 5LBSL 4TSBH 1EUUA 3LD8B 4QTHB 3D85D 1BOGA 4WHYG 2KQMA 1QQDA 5EB9A 4PLNC 3BKJH 3FQTB 5FM5M 3GRWA 1XF5B 4DN4L 4ORGB 2D31B 5EC1A 1W72B 3QQ9D 2I5YH 5B38G 4K9EH 1U2CA 4GMSH 4OJFL 3SO3B 4ELKB 1YMMA 3C6LB 4HJGB 3O3EB 3QI9C 1BD2B 2NXZB 4U31A 1TTFA 2XZCH 5F1NA 2XN9E 3HB3C 3HAEG 1S7XA 4QHMB 1UCBL 2XKNA 1PW3A 3KYOB 4OIBA 3SCMD 2DLFH 3SDCC 1HH9A 3TNNB 2HFFB 4I9WE 5BXFA 5I73C 1JZ2A 5C7XL 5JNYA 3U30B 4U3CA 1MHPH 2G60H 5DJZB 3UBXB 1CG9A 3CVHL 4GS7C 2MNUA 2HLAB 3BP6B 3BSZH 3CD4A 1WCQA 3LKRB 4RISL 4R4FH 1LQSR 1JF6A 3JV4B 1JUFB 2OI9C 1L6ZA 1QP1A 5DA4A 5HVFB 1ZA3A 5MP6L 1UACH 2MCG1 5BVJB 4JO4L 1TCRB 2OSLB 5DRZB 2R56H 3RRQA 4M7JL 2GT9B 1EZVX 4F9PA 3BZ4B 3IFNH 1T5XA 4GRMA 3MXWH 1PSKH 3WJJA 1LHZA 1NEZA 4ETQA 3C6LC 1MFDH 4DKDC 1DVFC 1UYWL 1IQDB 1G9MH 4GMTL 2HT3D 4X80H 2VDPH 1N64L 1MCKA 2M26A 4MXWH 2C3VA 1F4XL 3N85H 4YBQC 4QWWC 2Y07L 3PV6A 5EUOF 4K7FB 3S35H 3MNZA 2Z31C 3DRTB 4M5ZH 3AS2A 2BNRE 5I1AB 1M7IA 2FNBA 4ZNEE 4BA8A 2F5BL 4OKVB 1DZBA 4Q9RH 1MAKA 3BP4A 4I0PB 1N2RB 5LGKA 4Q0XH 3R1GH 1A6ZA 4BK4A 4G3YL 1AXTL 1R3LA 3RPKA 2CUIA 1VFBB 3RJQB 3EOYG 1M6OA 1HZHL 4M6AA 4Y5XA 1EVUA 4WTXA 5CSBA 5F7FA 3HNSL 4KMTH 2NY4B 1GAFH 3G08A 3KPSB 5JW4Q 4WU5A 4P4RB 5C0RL 3VGAC 3MLZL 3VRJB 5CD3A 2BCKA 1K2DA 4RBPH 5ICYA 4LCCB 5MERA 1D9KB 3VH8A 4IIQC 4JG1L 2QSVA 4LBEB 2K9UA 1UYWH 3UBXG 3OF6A 1OW0C 3C09C 3FFCD 4PGZA 4DUXA 5EZLA 4OZ4A 4PPTA 4UBDC 3IGAA 2XOTA 4XWOD 1F8TH 1QFWM 4XNYL 3ARVA 2E9IA 2OL3A 1JPFB 1KLUB 4L8CB 3NCFB 4N1EA 5F7DA 3ARZA 3NZ8B 2MJWA 4M7ZC 4PJ5A 4R2GC 3FT3A 5BS0A 2Z35B 1Q9WA 4MVBC 5HHQA 3WDHA 5JIIA 2RBLA 3PWPD 2NY3D 4PGEA 3ZKXB 5E6IB 3VXUE 3ARRA 2YA1A 5JIKA 4X99B 5TGBA 4JFFB 3R06A 4WFFD 4DN3H 3WLWC 2JK5A 3OZ9L 4QY8B 2H9GA 1CDJA 2OQJB 4LPWA 3WIIH 3DTXA 2J6EL 1MJUL 4P2QE 2NR6C 2BVPA 4CVZB 1P4BL 2HFEA 2BNQB 2R2HB 4OD3H 1ZT1B 4L8SB 4F8TA 4DVBB 3AAZA 4EN3D 3QFJE 4LP4A 1QD0A 4TSCH 1I8MB 4MNQA 2OTUB 2WAHA 4PBXA 1MIEH 3O2VL 3VFUA 1L7TL 4FFYL 3HE6C 4JZJB 5DHYB 3KYKH 2BNUB 3BVNB 3QH3A 5I18L 3CXHJ 3Q3GA 4XBGA 4XPHH 3CMOL 5D93C 1EAPB 1EEZA 1F3DH 4XGZB 5ADOL 4XVSL 4ZUTB 1BVLA 4G8FA 5DHVH 4J3VA 5MI0B 4XMPL 4CU7A 4XPBH 5CCKH 4K94L 5FYKH 3VXMA 3IU4L 3ZHLA 5EWIL 2BY0A 3B4NA 3QQ4B 2WINB 5EN2A 2Q7YA 5FK9B 1WAAA 1G7IB 1OM3H 4YHYB 4YR6B 3RP1A 5HHPB 4WUKH 1SMOA 2FIKB 2NNAA 4JRYA 4UQ3B 3FJTA 3HZYA 3OJVC 4PP2A 3KPNB 1RUPH 5DMJB 1D5MA 2FB4L 4NZTL 3CPLB 5KJRH 1DQMH 3N1GC 4KWUA 2VXTH 2L7UA 1NFIB 3ARYA 3W81A 5A2KH 3WFCH 3N0PB 3RGHA 3RUGF 4BQ9A 4XP4L 3E8UL 2IBZY 4K7PL 4ZAKD 5IVNA 3JTSA 3ROOA 4OZIE 1K4DB 3TO2A 1HSBA 4PP1D 4JZJC 4YDVA 3ARDB 5DUBA 1WAAF 1PFCA 3TYFB 2VB5A 4YK4B 3DX9B 5ENWA 1MFEH 5SWZE 2Y06H 4QYOB 3O3UN 5DJXB 3NA9L 5I1EL 5I0DA 4ZFOB 2E8YA 3O45B 3MNWB 1N6QL 1QA9A 3SKUD 1WVZA 2AEIT 2XZQH 2BC4B 3QDJB 1GGIL 5FO8B 4L4VA 2R9HC 3IETA 3CC5B 4H0HB 4MA7L 1ZK9A 1Y6KR 5E5MB 4K2UL 4OUOA 4WY7L 3VDBA 1XFPA 3UTZB 2VDQH 5KW9H 5AWNH 2BMKB 1RJLA 1VPOL 4MCYB 4FQXD 1R5IB 3TCLB 4NKMB 3E6FB 3KHOA 4F33B 3BQUA 4K8RC 4KZDL 1W0VA 43CAB 2MCPH 1I8MA 5EZIH 1FNEB 4K9EL 3ARGD 4Y1AA 4D0DA 4ZQKA 3JVGA 2IG2L 4YHZH 5CBEA 3BN9D 1DBAH 1SEQH 1CTNA 2NY0D 5HI5D 3MRRA 2I9TA 3N1FC 3MLTB 3FT4B 3NABH 1YMHA 4Y2OA 3S36H 3EO9L 3JTTB 4MHHG 3TN0B 5C2BL 4FQCL 1LP9F 3M17A 4LSPH 1CE1H 4MAYC 5I30H 5FUCC 2LAGB 1FFOA 5J0BA 4KUZH 4JZOB 1U9KA 1QRNB 5CINH 3SOBL 1G7IA 3QHFH 1IAIH 3VFGH 3RFZC 5B39B 1DANU 3DSNA 2BXZA 2IAMD 1S7UB 3CFKB 1SQ2N 4LPXA 4X5XA 4XAKE 2E9WA 3F7RA 3WXVL 2DYPB 5IVXF 3RVXD 2Y5TB 4TTGA 2I60L 3W39B 4AK1A 2IF7A 5ICYB 4PLKD 4HUUB 2YRZA 3QBTB 12E8H 3OXSA 4IOFD 5B8CA 3B2UC 4ZTPL 4N1HB 5CEZE 1MIEL 1X5YA 4MYWB 3C2SA 1I7TB 1CDCA 1GYAA 1EEYB 5SX5H 4IRJD 1PSKL 1ED3A 1S5IH 1HI6A 5IEHB 5TPWH 3STZB 1T0NA 3K8LA 2BSTB 5DD5L 5C3TA 4F7MA 1ZSDA 1R3JB 4MNGB 4CBPA 4KY1L 1H5BB 3B5GA 4OD1H 4ZAKC 3MNWA 2VLJA 1D9KA 3VH8B 3MRCA 1FNHA 3QO0B 4DW2L 5IW6B 3FO1A 5DQDH 2ADJA 2XRAL 1CXEA 1KTLA 4P9ML 3IDIB 1PDKA 1DR9A 3MRMA 2J5LC 3IGAB 2VXVL 4ZPTB 3SGJC 1ZHNB 3FMGH 1NCWH 2AP2A 5CZXD 4QRPE 4J8RA 5GS2D 5DYOA 3RZCA 4MA3B 4LLMA 4NT6A 5JHDD 1IQDA 2AKRB 5KJRL 5F7MC 2Z31D 1ZS8B 5INDA 5SV4A 3F58L 4ODTL 4PJFA 4L1DA 4WV1C 4GRWE 4D9RD 1CL7L 5IV2B 1OP3H 4OFDA 2ICWJ 2MKLC 3O3BB 2IALA 3FB8B 3EO0B 4LEXL 4K7FA 3BZ4A 5F9OL 4KDVA 2VXVH 2UWEF 1Z9MA 4D0CB 5JZ7D 2B1HH 2A38A 2EDFA 3TT3L 4KQ3H 1JVKA 4N8VA 3PGCB 3CH8A 4Y4FB 3LH2H 2VDNL 1YPZF 3HE6D 5AZ2H 1EAPA 1EEZB 1G0XA 4JFZH 3N9GL 2R4SH 3KYAA 2NY1B 5I74C 3MBEC 3V0AC 2PYEB 2XKUA 5D1ZA 5EULV 5C0IA 5E2WH 1IGIL 2R69H 1XGRA 2BZDA 2YZ1A 1A8JH 3D69A 4MMXC 3HZMB 2XFXA