1A0QH

29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
205
Chain Sequence
VQLQESDAELVKPGASVKISCKASGYTFTDHVIHWVKQKPEQGLEWIGYISPGNGDIKYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYLCKRGYYVDYWGQGTTLTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A comparison of the crystallographic structures of two catalytic antibodies with esterase activity.
pubmed doi rcsb
molecule tags Catalytic antibody
molecule keywords 29G11 FAB (LIGHT CHAIN)
total genus 42
structure length 205
sequence length 216
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a0qH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a0qH02
2R0WL 4W4OC 4HPOL 3E6HA 4ODBD 4PB0L 1KCRH 3BESR 3VI4E 4IJ3B 2MJWA 4GRLB 1IQWH 1LEGB 3KPSD 2VLRB 3TLRA 5L0QC 2BRRL 4WW2C 4JAMB 4LIQL 4DK3A 4R90L 4LARH 4NNPL 5HYSB 3RY4A 1U8OB 3FN9A 1IL1A 2BY0A 4J1UB 4P4KD 1KEML 2XWJA 4P2QE 3QUXC 2AGJL 2V5YA 1CF8L 2OTPA 4I13B 4NJAL 5DJDA 3V6ZA 4FQCH 3ROLB 1U8JB 1U2HA 5GGRY 1HINL 5ANME 1A9EA 1R0AL 4H1LB 5D5ME 2ZKHL 3IETB 2FBJH 4M7JH 4MZ3A 4K7FB 1RZJC 3EDFA 5FHBL 5JR1L 4E42B 3BFOA 1Q1JL 1C5CH 4N8PA 5KSVB 2DWEA 1R5VA 3NCMA 4ZAKB 2VITA 4ONGL 4LPCA 5EZJA 1GCFA 3H0TB 1OP9A 2A9ML 5GRXG 4Z95H 5HGBA 1A9BA 1NKOA 4PJEF 4JHAL 1S9WB 4CU7A 5CSBA 1CD1B 4PRIA 4W6YB 4HK3N 5ETUA 2ZG1A 3O3UN 4R4ND 3QIBA 1YMMD 3U4BH 1E6JH 4XCCL 5JXAL 2Q8AH 5K9JL 4LLUA 2Q8BH 3BP7A 1KC5H 1Y18A 4ZG1A 1UWEH 3ZHLA 4U7KA 4G8GB 5CP7A 1Z0MA 5DUPH 3FO9A 2X10A 3R06B 3N85L 1FAIH 4FNLL 2NY5C 4F7EA 5E2VH 1MH5A 3FJTA 3VG9B 2VDPL 5A43C 1GOGA 5GISL 2PYEA 3PV6A 2GFBB 3DMMC 5GS2D 1FVEA 5F6HJ 3L3OB 4ZUWB 4ENEC 3VXME 3ETBF 5GRVL 3VFUA 3I50L 1HHHB 2ICWB 2FHFA 4WHDA 1NGXA 1J1XH 2OJZL 4RAUB 1AGFB 2J8UF 1HHGA 2PXYB 5CGTA 3ZDZE 4F7TB 1UJ3B 3HRZB 4H88H 1EMTL 1IAKA 2OR7A 3X11A 1F4XH 5FM4A 1ZKAA 3LEYH 2VXSL 5SV4A 1LNUA 4N0CD 1DLFH 2JJVA 3B8YA 1AR2A 3OJ2C 1F8TH 4ACPA 5DRXB 5BVPH 3BAEL 4H1LG 3QG7L 2FX8H 2UZYB 5T5NF 1U41A 2WANA 1INDH 3SKMA 3VFNA 3L3DA 1AXTL 3U7WL 5BVJB 3OV6A 2B4CH 3ULSA 2XZQH 3AY4A 1JWMA 5CJ8A 4MJ5A 1NUNB 4L1DA 3QR2A 5FKAA 4K3GA 5C9JA 2XPGA 3IAGC 1CD8A 1Q9OA 4UIMB 5IGXH 2HFGL 3TBWB 2HTLD 3TNMA 4K71B 3QPXH 5DVKA 2AABL 5F1NB 5TQ0H 3I2CH 4MNGE 3N1MC 4HJJL 3QZWA 3T3PE 3BW9A 1RIHH 2YKLH 1UH3A 5ACLA 1PBYA 3UAJC 1DSFL 2DQCH 4PGJA 1H5BB 1UT9A 3EYQC 4JGUA 1MAMH 3IVKA 1BVKB 2IGFL 1JNNL 4PJ9B 4M62H 1QLFB 4PJAE 1Z3GH 3FQXA 2VQTA 3PJSA 3QI9C 5T3ZD 3ALXA 1KOAA 1G7QB 4PJIE 4XNYH 1BQLH 3TNNA 1OTUC 2OSLA 3SE3A 4EBQH 5J3HD 3GSQB 3FQNA 5IVOA 5E9DE 4P99A 4RMTA 3ZSTA 1SEQL 1R5WA 4JG1L 4CNIB 1S3KL 2NY6B 4WUUB 5IW3A 4Q9RL 3VFWA 3B8SA 3VFSB 4D3CH 4MDIA 1FYHB 4OLUL 3GSUA 3C5SB 4LSSL 2HTKD 4PV9A 3D39B 4MNQB 2CDGA 5D2NB 4ORZC 2OCFD 3LHPL 3W9EB 5D96C 4XPFL 5DJ8B 4FQJL 4AJ0A 4KK5D 4H0IA 4U1IA 5C0BE 7FABL 1W0VB 5ACZA 1P84K 4OJFH 1A1OA 2XQYG 2DQGH 2MQ0A 5IBTL 1OSPL 5DJZB 4ZSOA 1F4YL 1AO7B 4BYHA 4PR5A 2HT4C 2K1MA 4Y1AB 3WO4B 5I19H 1N6QL 1QKZL 3L5XL 4I3RL 2VLRA 3PL6A 4MA1B 3X17A 1UEMA 4P2RE 2B5IB 1KPUA 3VJ6A 3W81A 1V7ML 5C0GB 4X9IA 4KTYA 3HUJA 4JO3H 3KPRA 5C6TH 1WWWX 1SM3H 1XGQA 2Z31D 3KLHC 3RWCB 1QSED 4UT7H 1CGVA 1HWGB 3OAYK 1JP5A 3K7UA 5LQBH 4XVJH 4AEHL 3O4LB 1KJVB 1S7SA 4PV8B 5CP3H 5EBLA 3FFCD 4XT1C 4RWYH 2X05A 3EYUL 3ZTNH 1E4KA 1SMAA 4L4VE 4MJID 4FQLH 3NBNA 5IT2L 5IVZA 2FX9H 1T1WA 1QSEB 4M1GH 3LY6A 5CUSL 2ZPKL 4HBCL 4YBLC 3WKMH 2R2EA 4PY8I 2AKRB 1A47A 4UQ3A 4XVUC 4ZD3L 4J23A 2DQEH 2IALA 2JKXA 3MV7E 3T77A 3VXUD 2YPKB 1U0QA 1NCTA 4BUHA 4Z18A 5SWSB 2QKIB 2AXGB 1MWAA 2XFXA 1HQRB 4NSKB 4KZDH 1W8NA 4YGVA 2Z0BA 4HS6B 2OMNA 1I85A 3NZHL 4NKDA 5DUPL 3ULVC 2X6MA 3QIUC 1U8KB 4HKJB 4KI5D 3F7PC 2AI0H 5FKPB 5GSRA 2QQLL 1KXTB 2VERN 5GGRA 3V2AR 3F7QA 1RSFA 3QEUB 2P8PB 3QUMA 4G42B 1TJGH 1HDMB 1VFUA 3RP1A 3UO1L 5K9OB 3CFJA 3RUGF 1WAAE 5TE4H 2FWOB 4G7YH 4WV1B 3P77B 4PJ7A 4V2BA 3VWJB 3LEXB 1MLCB 3PGDB 5GHWH 2RB8A 1KENL 4EOWL 3F7VB 4MA8H 3MV8B 2CIIA 3WFCL 3T8XA 1A7QL 4GW5A 4C58B 3HC0B 1EO8L 3O2VH 4Y2DB 1OGAE 3G5ZA 1A7RL 3ZHKA 3L3KB 3AXLB 4X5XA 4KKAD 3MRGA 2VE6B 2G75B 1TVBA 4YPGB 1QRND 4ZOBA 5MHSE 4MXWH 2XWBA 3QDGE 2GAZB 4YO0B 5BVPL 2O61B 5AZ2L 4MD4A 3IDNB 3MRLA 4R4BA 4DGIL 1SYVA 1FZKB 1UWGH 3T4AA 1NCAL 1N6UA 1OVZA 3HZVB 4KU1A 3GMNA 3VGAB 1Q0XH 3PP4L 3MXWH 3MJ8A 4FFZL 3C5ZA 4LCWE 5DMGD 1B6UA 1KB5B 1ETZB 1AKJB 2HFFB 5I2IA 3LKRA 2BVPB 3I3BA 3FTGB 3L95A 4MMZC 2G2RA 1VADB 4DKAA 3VRIA 3LQZA 4Y89A 1VFOA 2OBGA 5CP3A 2H26B 4O58L 1FNEA 1PVHA 5I1JL 3O81A 4FNLH 5J12B 5FM5M 3FOMA 1I1FB 3VFPA 3G04B 2KBGA 4PYHA 4QYOB 1FH5H 5CP7B 5IEHA 2GCYA 3JWOC 1W0WA 1P4IL 3D48R 1ADQH 5IM7B 3CH1A 1GHFL 2UWEE 3QAZB 1FZJA 1RUMH 4QHKI 1L7IH 4GT7A 3RVWD 1K4CB 5E6IB 3U9PH 3OX8B 4L3EE 1H8NA 4Q97A 2GFBA 4QRTB 4KRNA 3NABL 1I3UA 1Q9WA 1BAFH 4QRSA 5KSUA 2YSSA 4LSTL 4H88L 3O9WB 5HGHA 3IDJB 5EUKB 2OS7A 3HPJA 4D3CL 5IJVB 5A16A 3QDGA 4FQQB 3VFVB 4JR9H 2HG5B 1I7ZA 1E4XI 5EC1A 4OQTH 5DURB 4RAUA 4PRHA 1JPSL 1RFDH 1F58L 2YUVA 4U1JB 1H8SA 4MXVF 4YDVA 1NLDL 3VXNB 2VB5A 4KK5C 1JHLL 1EFQA 1UCBL 3FAXA 3S34H 4H8WH 1FFRA 3BDYL 4TUJB 4Z8FH 3IU3B 3O3DA 5TDNB 5T3ZH 4S1QL 2Y6SC 4XBGB 1L0QA 2E6JA 2PUQT 4HKZB 5C0JA 5JLZA 5C0FB 1WF5A 4EIGB 1TNMA 4LVEA 3K81A 5CILL 1FNSH 3CK0L 1XH3B 2CLVB 3EZ8A 3RPIB 3MRJB 2BOCA 3H42L 1XF2A 1U3HA 3FCTB 5JW5A 2OQJA 1QVOA 1CVSC 2B1HL 1FNLA 4FG6D 3NIGE 3QUMB 4UOJA 1G7LB 1JYWA 3OZ9L 3MMEB 4N90E 4IRJA 3KPSA 3O4LD 4XVTH 2Z8WC 3KPPA 3QJHA 2C7UB 5C0DA 1Q9KA 3VXOB 3MRIA 1BD2A 2CIIB 4XC3L 3MNWB 1FNAA 2F8OA 3O6MH 5ESVB 1PYWA 1S8DB 4QOKD 3G08B 1G6RB 3WFEL 5E2WH 3RL1B 4L4VA 4N0FA 1B0WA 2XWTA 5F7EH 2GK2A 2BHYA 4PYGA 1GL4B 3ARRA 4J4PD 5C08E 1AXSA 5IHUH 3DWTA 1QHPA 3WN5A 2EDRA 1CZ8L 1TPXC 3ZE2F 2LAAA 3BKJL 3HMXH 3TGXA 4G9FA 1D5MB 4BQCA 2FR4A 3B5TA 4EQ2A 3SOBH 4YH6A 2ADGB 1NUFA 1CS6A 5IFJB 2GJ6D 5I73B 1KTDB 3D25B 3C60C 4JFOB 5AD0A 2GUOB 5ESQA 5DSCA 5CGMA 1NSNH 4ZSOB 4BFIB 4OIAA 4M8VA 5E9DD 4LU5H 2OXGA 3SDCD 3VXRB 1G7IA 4BH8B 1GGBH 3GSXA 4IRSB 4QNPF 4HGKC 3FO9B 3R06A 4Y4KC 5C0BA 2BVEA 1ZANH 4Y5YB 3ARUA 1QBAA 2Y06H 25C8L 3N06B 2I60L 3B5GA 1NC2B 1Z9LA 4KMTH 1J11A 4YLQT 2PTUA 5LG1A 2FX7H 2LQRA 3CDGA 1YECH 2DLFL 4MA7H 4DCQA 4JGMA 1B4RA 3MLYH 1OPGL 1NGPL 4Y5VC 4P2OC 5K93A 3PWJB 4LGSB 4O51B 1KCSL 3QDMB 1I7RB 2CDEA 5JR1H 3V5KA 3MSPA 5E2TH 1T66D 2VN4A 4YHIB 1WCBA 5IB3B 3N1FC 4P5TA 1S9XA 1TZHA 4V1DE 4KZDL 4XCFH 1D5IL 3AU1A 5EU4B 4HWZB 3H3PL 1UG9A 3X14B 5IHZB 1IEBB 4O9HL 4P4RB 4FQXA 2MCPH 4JFYA 1MWAB 2DLIA 5SWSA 2EYRB 2W9DH 1S7RA 2PW1A 3VCLA 3EYFB 4HKZA 1IQDA 3PNWA 4OZGF 3HCVB 1IAIL 5F9AC 4XP5L 5GS1C 1A4JB 5EWIL 5BW7C 5HYFA 3U30B 3NTCL 4MWFB 5ALBL 3FB5A 1D7FA 1S78C 4LIQH 2GJJA 1JN6B 1YJDL 1CTOA 5F3BA 3U83A 1CU4H 5CD3A 1I9RL 4EI6A 1VHPA 4AK1A 2R1YB 1A7RH 5MI0B 5BQ7A 2LE9A 1G7JA 1NEZB 3MC0A 4HHAB 3STLA 4RFNB 2MKLC 3UTTE 5CCKL 4FZ8L 1I85C 5J11B 5H2BB 2R39A 1NDGA 2CJUL 1PFCA 2YD1A 5A1AA 5I66B 5C2UB 5J6GA 5C07B 4PRHD 3Q6FB 1NDMA 3FT3B 5F44A 5KSBA 1WZ1H 2R2CA 4MQXD 1NCDH 1TVHA 1ZVYA 3MRLB 4QHUA 2YPVH 3JWOH 3MR9B 4WW1A 1A5FH 5FO7A 4KV5F 1FHGA 2OL3A 4JFDA 1BHGA 4DOHE 3MLZH 2H1PL 4OBRA 3ILQC 3DXAB 2BVOB 3SGJA 4CMMB 2BCKB 2P46B 3HPLB 5JIHA 3C6LD 4RMUA 3SDDD 4HH9B 5I30L 3QHFH 4FXGB 4KK9D 3SPVB 3QXAB 4OQTA 3RRQA 3LPFA 5LWYH 3U9PL 2ZCKH 5H37H 2XXMB 3DARA 4XRCB 5DHVB 5D2LE 5D7SL 4F2MB 1RUKL 4XWGL 4GSDH 4PRIE 2PTTB 4KZEL 3UTSA 2OL3L 4DW2H 3GM8A 3OQ3B 2JF1A 4YHKH 1E4XH 2F15A 4Y5XB 3OKLA 3EO1B 3BXNB 2P5WB 3DOSA 4GAGH 1A7BA 4WFGE 1A2YB 3HC4L 5TDPA 1XCQB 3MFGB 4N0RA 1RK1B 1IKNC 4JY5L 4RCAA 5IEKA 1DQDL 4GRWF 1ZAGA 2VQ1A 5EO0A 3QG6B 1MEXL 4M9OA 5FA3B 3T2NL 1VSCA 3TESA 3QNXA 1ZLWH 3BIKB 3H3BC 5HI3D 4GFTB 1IFHL 1QO3A 1FG9C 2JJWA 2EDJA 3ROLA 3S36L 1MLBA 3W0WD 2QSVA 2A6KB 1OGTA 2VXSH 2VDLH 1ACZA 2ZSWA 1EA9C 4R0LA 2VWEC 1F8TL 2AV1A 3RJQB 3F62A 1MCOL 4P2QA 2FBOJ 5ESAB 2DQDL 3QXTA 2R4SL 5D71H 1CLCA 4ZUVB 3GEWB 3I3DA 1VPOL 4XX1E 1JGEB 1MCIA 4XBPA 3NN8A 1MCWW 2XZAL 1CXIA 1UVQB 2HH0L 4NZJA 1SJHB 2J3SA 1I3RB 4Y5XC 3RVUC 2AEIT 3ZDYF 1AJ7H 2YD8A 4XBEH 4F57L 5I1LB 3B9KB 2PXYD 2VDOL 3QXWA 5GQBA 4URTB 3L7EB 4JFEB 3SDCB 4LSPH 4OIBA 1K5NA 1LILA 1AGDA 2P45B 2DQCL 5J56B 2PYFA 2DKUA 2ZUWA 4ETYA 3C5ZD 3QI9D 1ZSDB 1T2XA 2HP4A 5L8JB 1UZ8A 4NCDA 3EYVA 1LK2B 3NIFF 5JQHC 1NBZB 3ISWA 2R4RL 1DP0A 4HHAA 3STLB 2CK0L 4Y4HD 3WO4C 4K7PL 3QP3A 5IBLC 5C3TA 1X5ZA 1AD0A 4X6DB 4YHZL 2ID5A 4NZRH 1U3YA 1IZJA 4HDIB 5EU6B 5KS9A 1DQLH 3EFFB 4E5XA 2CMRL 2C4FT 1KCVH 4IHOB 2GYSA 2V2WA 4LOUD 3QYCA 3O6FC 3BUTA 4X4XB 4XWOC 4OLUH 4Z7VF 3CZFA 4HG4J 1X4YA 4JPKL 3O6FD 3PDGA 4JFFB 4ODSL 1N8ZA 5JNYA 4GMSL 2XKNA 1LD9A 3BRGC 4GXVL 2JB5L 5FB8B 4OLZH 3D25A 4JO1L 1UFUA 3U79A 1RAMA 1NL0H 3KJ6H 3SDAD 2DJSA 1S7TB 2NNAB 1I9IH 3FHAA 3ZL4L 4I3RH 4LEOA 1H0DA 2KZ1B 3KDMA 2J8OA 5L2JB 3B43A 3U0TB 4JY4A 5CEZH 5JW4M 4FZ8H 3GSOA 1AO7E 4OIIH 3CH1B 4OZGA 3RWDA 1Z2KA 4LOUC 5T3XD 5EU7E 5BQ7B 3IFPB 1BWWA 4HUVA 1OAQL 2C1PA 2IPKB 3HTLX 1BFTA 3DETC 4X6EB 1I8IA 1OP5H 1RJCA 2EDHA 5D1ZD 5DJ2B 4BA8A 5GS1B 1ZLSH 4FFWD 2EDTA 4HKBB 3BSZH 3VW3H 4RMSA 4OFIA 5DQDL 4DCQB 4CN6A 3MRMA 5EA0L 3NPSB 1UQSB 2HVJA 3CFIC 4LRIC 2GT9B 4WUUE 3LN5A 1YYMH 2BNRB 3VFUB 1T2QH 4JJ5A 5L8LB 1FFPB 3DVNA 1NLBL 1KJ3L 1E27B 3S97C 3CFDB 2XY2A 4X99A 4ZXBC 3FL7A 5HGAA 3MROB 4P23A 1BD2E 2QHRH 2NCMA 1AGEB 1GRWA 4OZHF 3SO5A 2ZUQB 1RY7B 2QBWA 1IVLA 3L5JA 4FZEL 3ARGB 5F1SA 4LASL 2R1WB 4KPHH 3VGDA 4UI2A 4TTDD 3JUYA 4HFUH 3P11H 5T1KB 2FZ3B 4ISVB 2AI0L 3MRJA 1UM5L 4GRWB 1RUAH 5IW6A 3CX5J 3CFEB 5DEFB 5HHOD 4HZAA 2H41A 5ABDE 3BUYB 4U6XA 1ZA3A 3UO1H 3W9EA 3QNZA 4XPHL 5F88B 5CCKH 4PY7A 4EJ1C 2VAAB 5GJTH 4UAOB 1T0MA 1LEGA 2A6DB 3IFLH 1I1AD 4KJPD 5MEPA 3OAYH 4R3SB 1YQVL 4D94A 5C0DB 1EHAA 5IR1B 3ARFD 4LSTH 3KHOA 4R2GC 5I1KL 5DD3H 1Y6KR 3WIFB 5E94A 3UC0L 2X4UA 3IVKB 3G5VA 1KT2B 5FV2A 5MP6H 1HILB 5E4IA 4MB5A 1D9KC 4YWGL 1RHHB 3CVHB 1ZGLA 1WVZA 1CD0A 5FUCC 4X83A 1FGVL 2P1YA 3IRZA 3ZT5A 3S34L 4YBQC 3PP4H 1CFQB 2VR4A 5CKGA 2EDNA 4I0PC 2ZSWB 3O2WL 2D31A 1FFNB 3DXAD 2AEQH 3FO1A 4YE4L 4BFGA 4EN3A 4UDTA 3UTTB 1F45A 4NUJB 3KLDA 5AD0B 3MV8D 32C2A 4NP4L 2X1OA 1OAYH 3J8F7 1LK3H 1BQUA 5FGRA 2OLDA 3BZ4A 3P3YA 4KZEH 4Z78B 1N59A 1JNHB 4LBEB 1JGLL 3OKNB 1BQHG 5E8NB 4X6CA 4YGVB 1FCCA 1ZHNB 3Q1SH 1ZE3C 1OAUH 2D9CA 1A3RL 4G8IB 1JPST 1GHFH 1NC2A 5D4QA 5C8JA 3WO3B 1HHJB 4ODTH 2QTEA 1A1NA 5D1XA 3X12B 1H3TA 3BEWB 2B4CC 3GMQB 1U8HB 4M00A 4QXGL 2AQ3A 2H2PD 1S9VB 1T6VN 3CXDL 3MNVB 3I75A 5E7FA 4N90D 2F53E 5HI4C 1P53A 4KHTH 5B39G 3S36H 2R0KL 1NAMH 1IC7H 1ZGLM 5KTEH 5I17B 1MREH 1PEWA 4ZNEA 1HI6B 4Y4FD 4ZUTA 2Q76A 4NT6B 1J05A 3LRGA 2ICWA 4WI8A 3MO1A 3TZVA 5ID1A 4YHML 1DE4B 4YAQB 4OFVA 2XY1A 4OI9A 1J87A 2R15A 5ANMB 1KLUA 3HMXL 2JJSC 2CO7B 4X0KB 3VFWB 3VFSA 3HZKA 1XGYH 1EEZA 3QDJA 3FMGL 2X70B 2XKSA 5CEXB 5GZOD 3R8BB 4I0PA 4MD5A 4ZUVA 3LRHA 1QSFA 2ZJSH 4JHWH 4P2QB 4MNQA 4DUWA 4Z7OF 3FB8B 3C08H 5TF1L 2XNAB 3WFBL 3FQTB 3N50A 3K8LA 2JJTA 3OJVC 4YFLF 1SY6L 3B9KA 1ZHKB 1GGBL 2N7BA 4AH2B 3IJHB 1RZKH 4YXHL 2YPLD 4MAYC 3I02B 3LRSB 1U42A 3VW3L 2YBRA 4KMTL 4Y4FA 3RWHA 5CZVL 2HKHL 5HVFB 2EO1A 1HOCA 4HUVB 5E00A 3PWVB 5I76B 1HDMA 5IBLD 4PGBB 1ZEAH 1ZTXH 5DUBA 5F7KC 1NBZA 5AZEH 4NWUH 5IVXF 4XP6L 1A1MA 2BMKB 3MV7A 1Z9SA 3V5HB 3G6JB 4JFFD 1FZJB 2BFVH 4PJGF 4I9WE 3MZTA 4NBZB 1EIBA 4MS8D 4LCIL 3DI2B 1A9EB 4Y1AD 5HDBF 5I0ZA 4HV8B 2NR6D 3K80A 1VEPA 2YZ8A 5IVXA 2ZG3A 4EUPG 2D7MA 2IADA 3IB4A 3MRNB 2A6JA 4X5XB 5BS0A 5ISZB 3CSYA 3PIQB 2GQHA 2P47B 2ESVE 3KYKL 5H35B 1KGCE 2V5RA 5CGYD 3F5WB 5TE7L 2C1OA 4WO4A 5J9PB 1CE6B 4KJYB 1AY1H 5GISH 4EZMA 3RAJL 3T1WA 2VWEE 2D7QA 3LKNB 5FOJA 3KPNB 2EE6A 2AXGA 3C5ZB 4LSUH 1AR1C 2YD9A 3D39D 1E0OB 1RURL 5ADPL 3OAUL 1ZHLA 3CSBA 4CVZA 3KJ4B 1MJJB 3KAAA 1U8QA 5IP4A 4QRPE 4OZFA 1H0DB 4LP5A 5DFVC 3ARXA 3L1OH 1QUNA 1DVFC 4UQ2B 5T3XL 3UROR 3EFDL 2ZZUT 4I0CC 5F6IC 3FZUC 5DD3L 5H94B 2EDFA 4A6YB 1IEAB 3OGOE 3DYPA 1DR9A 4TSBH 5CINH 3QEHA 4FTVB 1NAKH 2J8UE 3AM8C 2DS4A 3O3BA 1BECA 2A9MH 3D87B 4WJ5A 1C5BH 4OQ1A 2X9WA 4N5ED 1UACL 3CLFH 3HC0A 2D7TH 3DTXA 1HHKB 2OM5A 3F6IA 4M7ZC 2WP3O 4YHOL 3D9AL 2I07A 1BZQK 2P43B 1NAMA 2DIJA 4JFHE 5TE6H 3VFOA 2DM7A 4HPYH 4QWWD 2F54B 2CRYA 1ZLVK 3MNZB 1P4LB 4PJIA 1CDHA 3P9MA 4HZLA 3P11L 5E5RB 3QCUL 3KGRA 4PJAA 3REVA 4QRRB 2D31B 1G9NC 4XB7A 5EOCJ 3TH3T 4KTDH 4HUWA 4IDJL 1KN4L 4FQXC 1TQBC 2H45A 2J4WH 2RJMA 3OXRA 3HR6A 1G9EA 5FYJE 3W2DH 3IF1B 4M7LH 3ARDA 3TWCH 2HYMA 4NWTL 4M6NH 4QO1A 3FTGA 3F58H 3L95B 5TDNA 4FQ1H 5FAAA 1MPAL 2X4TB 3CDCA 2YMXL 4XP4L 2DQJL 1FV1A 1LDPH 3MRDB 4UIMA 2E5EA 2BY3A 5T5FL 1ZA3B 3AS0A 3LKOA 5DLMH 4AM0B 2VLJE 5L8KB 5DDHA 3O3AA 5ESQB 1WWCA 4G6AC 4S11A 2C3HA 5ICZB 1JFQL 1JCKA 1X5KA 4DQOL 5IB5B 5DMGC 5KAQF 2NX5B 5IHLB 3LRSA 1OSZA 4MCZA 1D9KD 1HH9A 1RIUL 3HE7A 2GY5A 4P2CG 4D0CB 5GGSB 5C0EB 3AM8A 4JM2D 4YHMH 4HQQL 1J0KA 3VA2C 1BEYH 4Z6AT 1G7MA 1I9JL 4Y2OA 4OJFL 4MX7B 3TNNB 2WIMA 4WI3A 1YEIL 3QDGB 5GGTA 1EHLH 3LS5L 1WIUA 3QPXL 5TQ0L 1G6RA 4HV8A 1TLKA 4BM7A 3BKYH 3P4MA 1T3FA 4NQVA 1A0QH 4AT6B 4PUBL 4MDIB 4KQ3H 1A8JH 1GPOH 4FQHA 3FO1B 4KAQH 4LSQH 5HHMD 5TF1H 4DKEH 4WFEE 2HKFH 2PR4H 4IS6A 1GGIL 1U91B 3WHXA 4E0RA 1YYLH 3VA6A 5H35A 1DVFB 5MI0C 5AG9A 2BY1A 4OFKA 1DLHA 1MY5A 3MBXH 4X6DE 4MQSB 5C0JB 3MV11 3FB7A 4JFDD 1D5MA 1PX3A 3W82A 3EHBC 5C09A 5IQ7H 2JCCB 2APXA 4LPXA 3S35X 1IC1A 3ZTNL 2NY3D 4FA8A 1QFWM 2WP3T 4B7LA 2X40A 3O8XB 4N1EA 3GMMA 3Q3GB 1MJJA 1VB9A 2DWDA 1ZLUH 3U4EB 2YRPA 3B6SA 1CCZA 4JFEE 3QEGH 3X12A 3RWIB 1WFOA 1SHMA 4UDUB 2X09A 1OQOA 1HHJA 3MOBH 2DI9A 3IFNH 4L9LB 3FN0H 4ZOAA 3AGVA 4Z7UF 1OARL 2ADJA 4PRNA 3QPQD 2VLKD 3JSSA 5DD0L 3JWDC 2DMCA 3MV7B 1A1MB 1QPXA 2BMKA 2H6PB 1GXEA 4YHLL 5EO9A 4PJCF 4XPFH 2E6QA 1NEZA 3RIAK 1CGTA 4K3EH 2EICA 3MUJA 3NZHH 4R4NC 3S37H 3UDWA 1I1AB 2VYRE 4CDGC 4EDWH 1YPZE 5J8OA 1N2RB 1FYTB 1M7IA 2UVFA 4L4VB 4N0FB 5ICXA 1KTLB 2WBWB 4GLRH 3HPJB 5DVLA 5D5MA 4R96B 4HGMA 3BWAB 1EH9A 1CDYA 4KJQD 4UV7H 4KKCC 1R3JA 4JPKH 4P23B 2ZJSL 3QWQB 4JHWL 1EO7A 2FL5B 1UJ3C 2ATKB 4CN4A 3WMSA 35C8L 4ODWB 3K8KA 4GXVH 3MNZA 4P2RD 1IGJA 2R4SH 2AXHA 3UYRH 1U58A 4GAJH 4P5TB 1RUQL 4K7FA 1KIRB 2P24B 2QKIA 1LEKA 4JRXD 5T3XH 5HYJB 3ROOB 4P2QD 3D3VE 4R6UA 4YXHH 2FLRT 2P5ED 4XVJL 2VXTH 5DRZA 5IHZA 4YHNB 3IF1A 2DWEB 1ZT1B 3H9SB 4TYUA 1BF8A 4UMGA 5FUOH 5JUEH 3RDTB 5JHDA 1CXHA 2DTML 4Y1AE 3T3PF 1WIOA 3ULSB 1PSKH 1IRAY 3UZEA 1A4JA 1SMOA 4PRIB 4D0BB 2BVOA 4XP6H 2W07A 2JELL 1J5OH 1OW0C 3CLFL 1UACH 1MLCA 2ARJQ 4M48H 5DO2D 4N8VA 3Q6GL 4GMTH 2CLRA 3MXWL 4R9HA 4LCIH 3MRPB 4LQ1A 2WM0A 4PGDB 1KB9K 4EI6B 2GJ6B 5I1GL 4MA3A 1KTKE 3C6LA 4X8XA 2R29H 3K1DA 1JI1A 4TULL 4XH2A 4PG2C 3BPOB 2VDRL 2XN9E 3TYGH 3BI9X 5EZOL 3JV6A 3I6LE 3VRJA 1Z9OA 4KJPC 4OD2A 4BQ6A 3AREA 5HDLA 2YPLE 1YA5A 3QDMA 5LBSH 2J4WL 3UDWC 1A6WL 4ODHL 5CLTA 1PEZA 1YMME 4X7TA 2QEJA 2VZOA 3SE8H 2VQ1B 1MCRA 2AJSH 4J7RA 3WFHA 5DI8A 4KVNL 3S3SA 3L6FB 5HSFA 3OAUH 4Q2ZB 2ZUXA 4QY8A 3FFCA 1IGFH 1UJ3A 1LO3L 4Y5YC 3THML 4XCNB 3KJ6L 2XQBL 4I9WD 1ZT7B 5AYUL 2UUDK 1IC5H 2N56A 1LO5B 2HJKB 2H2SD 3LKQA 4OV5A 1FNGB 3IAPA 2OTUA 3HHRB 4ZODA 3OKOA 4MWFA 4JQVC 2DIAA 4AM0A 1BIHA 4NRZA 3SGEI 1TJHH 1XF5B 4JQIH 5BO1H 1I1YA 4DGIH 1BBDH 4HQQH 1GGYA 1KBGL 1KF9B 1CL7I 2C3GA 5IB2B 2NW3A 4IJ3C 5CMAB 1IZKA 5LGJA 4BZ2H 3O2DA 5D1QA 3TIEB 1Q9WB 3MACH 4QRSB 4GBXD 5DQDH 3QCTL 4KFZC 5EA0H 3NAAL 1SYSB 4MD0B 3F12A 5I1CL 5FO8A 5FYJD 4KQ4H 1FL6A 2VZSA 5SWQA 4PUBH 4LPWA 3PQYD 2ZUSA 4HEME 4NKMB 3K1KC 2LVCA 4S1SH 2B7DT 1QBML 3RGVC 2XTJD 1INDL 3F7YB 4JDZA 1X5LA 3QULA 1OTTC 2JK5A 4QCIB 1DFBL 2DQUH 3H42H 4Y5VA 2ZUUA 4PGCB 4V1DB 3JV4B 4N9OB 3W2DL 3QG6A 1FH5L 1M7IB 1ZS8B 5H8DA 4UTBH 3CUPB 4JLRA 4NWTH 3DMMA 2EDKA 2QADB 1PZ5B 4TUJA 1PDKA 3QDGD 1A3LH 2AK4A 2V5MA 3UTQA 4XHJD 4PJ5E 4NPYA 2BXYA 3FB8A 2AP2A 3GJFB 3OBAA 4GUPB 3FB7B 2YPKA 3TPUB 2NZ9D 2A9NL 5B4MD 3AAZB 1TCMA 4EQ3A 3VDAA 1JZ7A 2B20A 4APQB 1E28B 3MPCA 1AIFB 4NQTA 4JR9L 5TQ2H 1TZIA 1HXMA 1F6LL 2V5SA 3QXAA 2HMIC 3GB7A 2OZ4H 3QPQC 1T2JA 3IGAB 1FP5A 3D85B 5SWZE 5DJ8A 5BZDB 4YGAB 4MLIA 5I76A 1HSAB 2A0LC 2HRPL 4YIQA 3R1GL 4ZXBB 3Q5OA 2YS4A 3RGVB 4MJ4A 5LCVH 5AAMA 4G8GA 2BNUB 3CXDH 3VGAC 3LD8C 1DDHA 4L4JA 4NQEE 2DMKA 2CRMA 3G6JA 1BBJA 2JB6A 5D7JD 5KTEL 4Y4HC 3SBWA 4PJDF 4U4BA 5DFWH 4JKKA 1A0QL 4WEBL 1S7XB 3GHEL 1NBVH 3MLXH 4LSQL 2FO4B 3LQAH 3HZYB 4N8CH 3VGHA 5HBBA 3UBXA 5HHNB 2NW2A 3UEZA 2E8ZA 3NFSL 4W6WB 3MCLH 1LEIA 4U1KB 4OD2B 2BNQA 1IKNA 3F5WA 2BNQD 2QL1A 4M43L 5E8OA 3GMOA 4PJCE 2CKBH 5C0NC 3DVNB 2NY3C 1TVHB 4DN3L 5GS2H 2AQ1A 3IT8D 2RGSA 3LSOA 1XR8B 5F6HI 2IQ9H 3BDXA 1C5DB 3N1PC 3ARFA 1RK0A 4ERSH 3ULUE 3FRPG 5KJRH 4NQSB 4LLWA 5FM5O 3V6FB 3PP3K 3D0VA 2IEPA 4AEHH 1EJOH 4ESKA 3WEXB 3GMMB 3Q3GA 4GW4B 4OV5B 3SDXB 1E6OL 2H26A 4P57B 4ODTL 2DQIH 1KN2H 3QO0B 5I6XC 3E2HC 2ARWA 2VDRH 5D1XC 5IESH 4K3EL 3KWWA 4WU5A 1CK0L 1FN4B 2XTJC 4FQ2H 1NFKA 5AWNL 5C0CE 1TTUA 4G42A 4FOMA 5BV7C 1KUMA 3L3IB 4ODHH 5INDA 2IANE 3SE8L 1CGUA 3ZYOA 3OSKA 3GM0A 1QYGH 4HUXA 1YDPB 4O5LH 3NFPB 4PPTA 1XGTB 1UADC 4G5ZL 1QLEH 4TVPE 3BWAA 5IMKB 5EU3B 1OP3H 1BLNA 2EDBA 3DX9A 5ICXB 2GT9A 3B9DA 4R7NA 5FUZH 4WFHE 3WS3B 1S5HA 4HWZA 4S2SB 4IRJC 3RWEA 3SDCC 4AEFA 4U0QB 2Y36L 3VWJC 2FX7L 1JGVH 2YK1L 3MGAA 2VDKH 2EYRA 1U8IA 3SJVB 4R0LC 1DBKL 1LNUB 3JTSB 5F72S 1IARB 3CXHJ 4GKNB 1SBSL 1A4KA 1HK6A 5JDSA 1RZKL 3QXVA 3BYYA 3V8OA 3KPQB 5LQBL 2XN9D 4N5EC 4P4KA 5FCSH 3U7AA 4AEIH 5KVEL 1HXMB 3PWPD 4HUMB 1K3IA 1HH9B 4KQ4L 2YPVL 3JVGC 4KDTA 1I1AC 5E5MB 3MRBB 2AJZB 3QZWB 3P0VL 3SE4C 2DYPA 2PKDA 3DIFB 4H20H 4K9EH 3O6KH 3GO1L 2BERA 4I8DA 5F96H 2P5EE 3QB7C 3T1FB 4ZUUA 5C6WH 3KPRB 3KPTA 2ARJB 3DVGB 3TIDA 5D70L 4HLJA 2R56H 5IR1A 4I48A 3MRCB 2UVEA 2ZCHH 3TBYA 4KI5F 5MENA 1JPFB 1K4DB 1R3IH 1RIVL 5ISZD 2A73A 5E2JA 1OB1B 1KACB 4WU7B 1IMHC 5IBUG 4LF3B 3JBG7 3VXRD 1HI6A 3HE7C 1IBGL 2AXFA 2OL3H 4XZUB 4GG6F 2YD6A 1UA6H 1OT2A 5A2KH 2G5RA 4WNQA 2R2EB 2MCG1 4NHCH 4GO6B 1T1YA 1ED3B 1Q38A 3LN4B 5FF6B 4OB5L 1FLRL 1YNTA 2FSEB 3E0GA 1BQHA 2IANB 4KY1L 3UTTD 3L7FA 1BJ8A 5F9OL 1LDPL 1WT5A 3TPUA 4JPIA 2F53D 5F7DA 3U6RA 3ARFB 4HXAH 3PWLA 4P59H 4MD5B 3TVMA 1BAFL 5F8RC 2VIRA 3TT3H 2F19H 1IFHH 3PQYE 3V52H 3MRQB 2F8XC 2NYYC 3B9EA 3U0PB 2W60A 4GBXB 1JK8A 1AGCA 1JNHA 1N59B 4LBEA 5IBUB 1BJ1J 3WNOA 3DX7B 4TSCH 5GS0H 4ALAL 5DUML 4NM8H 2D4FA 5GGTL 1D5XB 4G6ML 4BSWA 1MRDH 1C5BL 1LP9A 2QV2A 3KXFA 4JVPA 4OF0A 1RPQA 5LJYH 3MCLL 3ZE0F 5CJBA 3RX5A 1AC0A 1O7VA 1F90H 5T1LB 2KL6A 5F1IB 1G6RH 2R9HD 5C71A 5GS1A 2K7QA 3FRUA 4GBXC 4D9LL 4XAWH 3VXPB 5ERWB 4XWOD 5TE6L 3QHFL 2VDNH 2Q7YB 4ZPVB 2DL2A 5I1IH 2A2QT 1QSEE 2WWMD 1FVDA 4R0LB 3HKFA 5A40E 2VL5A 5DHYB 1AHWB 4JPVL 5DZNA 1G0XA 3GMOB 1KB5H 3RIAF 1H5BC 4PRPA 3HZVA 4NM4L 3OKYA 3ARDC 3PIQA 3CLEL 3EDDA 4XXCC 1U8NB 4FQ1L 1L0YA 1ADQL 1JI2A 5KG9B 4HIJB 3H9SA 3O4LE 2EEDA 2DQJH 3AAZA 1JF6A 4K7PH 1NGZB 2Z4QB 4FQXB 2AXJA 4W6XB 4CRPA 4M6OL 3SJVA 2KDGA 5DD1L 5I8KL 2LU4A 1QPPA 2CMRH 3RWGB 3GKWH 3V5DA 3MREA 4NC1C 1MRFH 1FVCA 1UKQA 3GHBL 4WI7A 2YUZA 4WO4D 3TCLB 2GJZA 3L5IA 2C9AA 2ZSVA 1A6ZB 2F54D 4JRYA 4QXTB 3MRRA 4RX4D 4LHUG 3WE6B 4F9LC 2JE8A 5HHQA 3SO3C 4UTAH 4I2XE 2YC1B 3H8NA 4LCYA 5C0BB 5JORA 3WJLA 3NFSH 3GIVA 4NHUA 1FNHA 4UNVA 2H8PB 4JB9H 3ULVL 1CDIA 5D2NE 3DUHA 5GRYA 3TYFB 1CIUA 3D39E 4Y19D 1ZV5A 2BJMH 5I1EH 3ZL4H 2ORBL 4I77L 4WFGD 1H3WM 2NTFA 3DUUB 2I26N 3TPKA 2VXUL 3TZVB 5DTFA 4LSPL 5I66A 4NCC1 3GI8L 4RGNB 4U6YA 1QLFA 3VG9C 3BQUB 3K4DA 5E9DB 4X0KA 1QQDA 4U6HA 2V17L 4ZFZA 4MD4B 4LPVA 1K3ZA 2NY3B 4QHLA 2BP3A 4LDLB 3EJYD 2JIXA 5EC2B 5INCA 1LWRA 2HJKA 3BP4B 4XAKD 4OD1L 4M93C 4JRXE 1XGRB 1OOAA 3HAEA 4EI5B 3SHSA 2V7HB 43CAA 2QR0A 3CFKA 4ONHB 3GZKA 2A1WL 4XI5D 1I8MB 4OLWL 2FHBA 3ZKMC 5ETUB 1TPXB 3GMPB 1KCSH 3CDYA 3VH8G 1URLA 1GGUA 4HIIA 4NDMA 1CN4A 1ES0A 3HNVH 1HOCB 3MRBA 3R4DA 3BJ91 3MBEC 3F7RA 2GCYB 3TBSA 1KEGH 3BPNB 2KUTA 3CVHH 1QLEL 4GRLA 4DJMA 1BZ7A 3L5WB 3MUGB 2EYTB 5HI5D 4RNRB 4JZJB 3WLBB 1WZKA 4PLJD 3KPPB 4PGZA 1I7TA 1LGVA 5FUZL 1J10A 4L29B 3I75B 2YD2A 1U8OA 1T22B 2CPCA 3ALPA 4P5TD 2HT3D 2ZCLH 3OGCA 5D93B 5EU3A 1A3QA 5EG6C 5DC9B 1FFPA 4X4ZA 5BZWB 4IIQA 4MAYB 2AJSL 2X1PA 4XP5H 5D1XD 1J05B 1FGNH 4GXUM 4TUKH 4P5KA 4TN9A 1MI5A 1YJDH 5EIQA 1Z5LB 1KLUB 4K3JH 4S2SA 3P4MB 3CMOH 1ACYH 3VFTB 3GSVB 1SVCP 3A67L 4HUUB 4APQA 2LU7A 4UV4L 1RU9H 1A6TA 3H9ZA 5F93C 1Q8MA 1OD7A 1DEEB 4JFZL 4D9RE 3STBA 4AY0A 2DTMH 5C0RL 1WITA 3W0WB 4TVPD 3INUL 4ZQKB 4UQ3B 4NQXB 5L7XL 4NRXA 1NGPH 4KUCD 4L8BB 2NY4B 5EBWA 4JN1H 4P46C 2JELH 1J5OL 3L3HA 2I25N 4HCRA 1B2WL 1JMXA 3T2OA 3OAZK 1IGTB 4O2CB 5E2UH 1D5ZA 3ZKQD 1O5DT 1IM3A 2VL4A 4F7PA 3WL9A 4RSVA 3T0BA 4C55A 2FJGA 3FCTA 4PRDA 5IK3B 2ZCHL 1MCDA 3PWUB 4HJJH 2Y23A 5F7HA 3MRHB 4ODUA 4FP8H 4LIQE 2VO5A 5JOPE 1UGNA 1DQJB 4YFDB 4MMXC 3DVGA 3TIDB 1ERNA 2O5ZL 5EO1A 5C0AD 5IIEB 4X5LA 8CGTA 1OM3H 4M61B 3B9AA 1I1AA 1H3VA 2XZCL 4AIZB 5ALBH 3SDDB 3G5ZB 5DMJB 3IS1X 3T0AA 1BQLL 5HY9B 2ED9A 1PKQA 2FECI 2E6PA 1YPZB 4ZS6C 1MAJA 2XA8L 3RL2A 4WHYH 2BOBA 1R3JB 1EBAA 1T5WB 4NKIH 4YPGA 4HIEB 1NCUA 2CGRH 5KSAD 2BVYA 4HW6A 4LLYA 3WUWB 5J1TC 1E4XL 3U6RB 5GZNC 4P3CL 2JIXB 1MFEH 1HYSC 3ARYA 3KPLA 3Q5TA 1U8MB 3CD4A 2X4QA 4OCYH 2Z35A 1ZHNA 3EO9L 1RULL 3KR3H 5D8JL 1OCWL 2W0KA 2XG4A 3VI3E 3W11C 3CFKB 1W0VA 1CTNA 4OSUL 5KSAB 2EIZB 5T1MA 3TO4D 1KIQB 3ES6A 3NIGF 5GGSY 1BVLB 4GKSA 1VADA 1EV2E 3MZGB 5I16A 1GAFH 3AB0B 5SWZD 2GTWA 3UPAA 3HFML 1CQYA 4UINL 2YRLA 4EXPX 1I7UB 4OGAD 4NCC2 5J0BA 5GSVB 4NKOA 1GZPB 1FG2B 1N0XL 2DQTH 2H9GB 5T1LA 3WXVH 4R2GB 1BPVA 2H8PA 4HWNA 1QFOA 4S1SL 2ZOKA 3MYJB 4KHXL 5D7LE 3RA7L 2J1KA 3OKKB 1Q9LA 3HLAB 5DJ6A 5J1SC 1A02N 2GK0A 4UAOC 4NC0B 1RD6A 1YEFH 2FDBP 3BQUC 2BSTB 4RQQA 3ZKXB 1DE4A 4F37K 3CLEH 3Q1SL 2VJXA 4HULB 6FABH 3QUML 1K8DA 3PJSB 2ILLA 2BSRB 2DLEA 2BSED 2NTSP 2ZCKL 2Z8VC 4P2OA 2IQ9L 4BKLA 3ARTA 4NJ9L 1G7HA 4YQXH 1MFDL 2K7PA 2VQUA 1B6DA 4U33A 3OF6A 2BC4B 3RVUD 3QIUB 2PF6A 1I7ZB 2A9NH 1R5WB 2DM4A 4PJHA 5HVGB 4NZTH 3GHBH 1GC1L 3ARGC 1MHHA 3HB3C 4LAJH 2R1WA 1WBZB 3GSUB 3ROOA 3ARGD 4HS3A 2LABA 3SKNB 3IJHA 1MVFA 2AW2A 4J8RB 5EIIA 1FVCB 4L4TD 5JXEA 1P5VA 4HGWA 3RWGA 1LVEA 5TF0A 1EVTC 3BN3B 1BFVL 2UWEF 2F8VA 4ONFH 3RVTD 2WBJD 4GG8A 5GZND 1NC4D 2NY2C 3BKCH 3H7LA 4DGVH 5DK0A 4L9LC 5KW9H 2EKSB 3FN3A 1T04A 2F74A 2B2XH 1T0NA 2UYLB 2NY4D 3RPIA 4PJ8A 5CJOH 5E8EB 5I15H 4HPOH 1EUUA 1L7TH 2PYEB 1S7UB 4N1HB 4PRBB 1A2YA 2FECL 1IQWL 3MRHA 3MV8A 3NCYS 1PY4A 5FM8A 1FIGL 1YZZA 3GIZL 3K8MA 4CVWA 1RJZA 4XH2B 4NQDA 4O02H 5K9QG 5KN5A 4YZFE 4BSJA 1DQMH 4OGAC 4U31A 5E8DL 5CBAA 1QO3B 2O26U 4F15B 4X5WB 4RA3A 2VDOH 4QF1B 1UZ6F 4PJXB 4X98B 3NCBB 5L7XH 3WFHB 3AUVA 3IJSA 4XC1L 1P7HL 3PWLB 4U6VL 3S4SB 2DQEL 1G0DA 1WZLA 3RWFB 3ARGA 3FONA 4YXKL 2W60B 4POZD 1IAOB 2ZUVA 3DLQR 3O6FB 1G7PB 3IDIB 3PE9A 4ONGH 1MFBH 3QO1A 5BOZG 1U8MA 1KNOB 2RIKA 1T7YA 2CXKA 3MUHL 1U93A 3OKNA 3NVQA 1YMHB 1KCVL 1IGYB 1QFHA 2FD6H 1LP9B 5ID0A 1WAAF 2GI7A 1MF2H 2G5BA 4PRAB 5DR5H 3BQUD 1H3PH 5BS0D 4M7LL 2EKJA 5DYOB 1HSAA 4YIQB 4H1LH 3VXRA 4M6NL 4X4MA 3DX6B 4XNMA 3IKCB 1AI1H 3MXVL 4ENED 4X6BB 1GGCL 2EYTA 3TA3D 2X4PA 1L7IL 2P5WA 2H6PA 1IL1B 3AS1A 3BMWA 2X4NB 3EYSH 3EDKA 5KS9B 1WEJH 4Z7UB 4JO4L 3T0EA 1KSRA 3CMOL 4IHOA 2HRLA 1F2XK 1CICC 3G5VB 5A16B 4PJCB 1N3NB 2R9HC 5FYLD 4XPHH 3FQUA 3FT2B 4HUKB 4K71C 1XAUA 1J0HA 2EEAA 1FL3B 3TZVD 5B3NA 3KYMB 3C5JB 4QOKB 4CL7A 5SX4H 1UWGL 4DGYL 4PLNC 1MUJB 3G5YB 4K3DH 2WK2A 1UM6L 1UCBH 1X9QA 2BSSB 5HDQL 1GIGL 4PJFF 4JANB 4LNRA 4Y19A 3BGFB 4DVBB 3LVEA 1BJMA 4P9HC 3HFMH 1NGWB 1REIA 4HC1H 3L3HB 1YY9C 3F6LA 3OKOB 5GIRA 4TSCL 5GS0L 1WC7A 4LEOB 4L8BA 1DLFL 4KKNA 5DMIL 4ZNCD 2ED7A 4KKBD 5EIIB 4DKDC 4OCXH 5DJ0B 3TO4A 4M7LT 1GPOL 4KAQL 4JHZA 4E9LA 1XR9B 3WYRA 3V7MA 1LMKA 1T0PB 4NBYB 4DZBA 4JN2A 3TN0D 4Y0GA 1HHIB 2HFGH 4NN7C 4NQCA 1RIVH 5HTSA 3AS2A 4WFFE 1UKTA 1GOFA 3RTQA 2XTLA 1UXSA 3B3IA 2R23B 2WLYA 5D7IE 3VFRB 2R69H 4E5XB 2FCBA 3C2AL 5BRZD 2C4XA 4LVNC 3TH4T 2N1KA 3D2UA 2AJXH 1YY8B 5T3ZE 3U9UB 3IDNA 3DGGB 2BOBB 3RHWF 5DWUH 4OT1H 1BZ9A 3FFDB 4PJXA 4IOFD 5ECJE 2F53B 3IFLL 1KJ2B 4JPWL 2FGWH 3VGEA 1YQVH 5BV7B 2DQHL 3BKJH 5C0AE 5SX4I 4OLVH 5DD6A 3AMKA 3ZDXF 3IJYB 1EGJH 2FJFB 2B1AH 3I6GA 5DGRA 1EMTH 4KJWD 5TJWK 1MQKH 4DGVL 4S0TD 3BO8A 2RFXA 1F4XL 5J57B 1KULA 5C9KA 2EDOA 5IOPA 1DL7H 1NBYB 3BKYL 3SGEH 4UBDC 5TFSH 4NZDA 3LS4L 1MIML 1A4KB 4WDIA 5BVJA 1MY7A 5K9OA 2YEZA 1I7UA 4U1SB 3I02A 1F90L 1S7QB 3O2WH 4IEFB 4L29A 4U1NA 1ORQB 4LAQH 6FABL 4Q74A 4PRBA 2W65B 4PJ8C 4ONOA 1ZLVH 1UH4A 3F12B 3MCG1 4LCCA 4OLXH 3DETD 5I1HH 3WJJC 2BX5A 2CRIA 2YKLL 3I6KA 4YQXL 3MLYL 3EOTH 3QBTB 5CBAB 5IJKA 4NN6C 4OZIB 4HCRH 4K8RC 3ZKND 3VFMB 3EUUA 4JFED 5TDOB 5KOMC 4PJ7F 2NXYC 5E95B 4PGEB 2YR3A 4RFEB 4YK4C 5B8CB 2HKHH 2BDNL 4BKLB 3LQAC 5C92A 2CKNA 3FT2A 4LFHD 2YPLB 5JXED 1T7ZA 3MLTA 3IYLW 4AQOA 1HZHH 1I8KA 1EXUB 2XN9B 4OCNC 5CIPH 4JFYB 1T1YB 1A14L 7CGTA 4MJ6B 2AQ2A 2YXFA 2EC9U 4TVPL 4HMCA 4ZS6D 2EDLA 4HKXB 4FQPA 4F8TA 2ICCA 4P48A 2GJ6E 1ZK9A 3QIWC 5F7UA 5KS9F 1ZOXA 4LLQB 1D3CA 3VFGH 1UZ6E 4I3SH 4UU9A 3KWWB 1QVOB 1X5HA 4XB8A 4KI5E 3RNQA 4Z7VA 4JG0L 2DQGL 5IBTH 1OSPH 5FDYA 5HJ3B 1FYTD 1YNLH 4NO0D 3FMGH 1U9KA 4RGMB 3HE6D 1BBJB 1HN1A 5LGHH 4P46A 4OV6F 4WWID 1P2CA 2Z8RA 3SJVD 1I8LA 1NGQH 5D6CA 3GI8H 4YDKL 3WDHA 2D7NA 5D1ZA 5D93C 4KKAC 5IMKA 4Z5RB 5HYJE 3MOQA 4MA8L 4FS0A 2NW2B 2LAGB 3ILPA 2MQ3A 1GYAA 1T1XB 2XWTB 1K4DA 4JFQA 4LPYA 5DJAA 3QWRD 3E3QC 3LH2L 5DJDB 3V6ZB 2BNRE 4KK6D 1CICA 2Y5TB 5JIKA 1FL3A 5GJSH 4TSBL 5D7KD 3L3GA 1QRNE 3QCTH 2R1XB 2VL5B 5DHYA 1W72B 3OKEA 2QJDA 5D7IB 3TYGL 1X5XA 1HKFA 2A1WH 4OF5A 4P3DB 5EBMB 4KI5C 3BRFA 4LFHG 4NRZB 2EE2A 1Q0XL 3WS6A 5KSAA 4I2XB 1B2WH 3QO1B 2CK2A 3ZO0A 1WFNA 3VXSB 4CMMA 2XI9A 4ORGA 3HNVL 3O6FA 4LMQI 4TNWF 3EJJX 3SE3C 1JZ4A 1S5IL 4PRAA 1PG7X 2XIDA 3G6JF 4KGJA 1BWMA 3BP7B 1LO3H 4F2MA 3BE1L 2ENSA 1FSKB 5D7SH 1I9RH 3N9GH 2NPLX 3SDXF 1J8HE 2VLME 1KN4H 3NA4A 5JTWA 4HWBL 3EOAA 1X5YA 4KDTC 1ZVSB 1T5XB 1VESA 4LCYB 3NFNA 3LZFL 2EIEA 4OF8A 5B39B 1TITA 3K2UH 4PGCA 4AMKL 3SE9L 2CH8A 1RUML 4I1NB 4RIRA 3MLRH 2FGWL 3R1GH 3I6KB 4MCYB 1MEXH 3T2NH 4XVUD 1EO8H 3O2VL 3AC0A 1XIWA 4ZFOL 3C6LC 5HHOA 4WEUD 1F3DJ 3EYOA 3SO3B 2GITA 1F5WA 4NQVB 1N26A 2HAZA 3BISA 3RY5A 3WKNA 4NBXB 2APFA 2A38A 3ARPA 3QUYA 5I74C 4OCYL 3QSKB 4Z7UE 1QFUL 1QSFB 3AREC 1RULH 3MUZ1 4PP1C 5FO7B 3B5HA 2Z92B 3BZEB 2X4OA 4Z8FL 3KYOA 3EDJA 4FFZH 2BK8A 4TRPH 1OF2A 2CDFA 5CD5C 4BQ8A 4U05A 3HE6C 2QR0B 4M6ML 3KPOB 4WY7L 4XBEL 2OK0H 4NSKA 2YEZB 3M1BB 2PO6B 1CD9B 4Y5YA 2G60H 4DTGH 4ETQB 4HFWA 3QEHB 4OGYL 4KQ3L 4RISL 1OTTD 4KHXH 3V6OE 1VDGA 2E7CA 2DAVA 4KTDL 1H3UA 1JPGB 4Z76B 1R5IB 3WHE0 1OM3L 3MJ9H 1CFVH 2IH3B 3L3JB 4Y5XA 3F58L 1LEIB 1OP3K 2FRGP 5HHXH 3DO7B 4ZDHB 4OT1L 5JA9A 2HWZH 1NFIB 5KOVC 3DNKA 1TFHA 5IKCB 1IM9B 3T4YB 3IDJA 3DUUA 3NABH 5D1ZB 4QRRE 1MFDH 5LGKA 1DQLL 5EUKA 2Y5EA 1NUDA 2EXYC 3QDAA 4NKIL 4QRRA 5T33H 1XFPA 4XMLH 5GGVL 4ELMA 5I1AA 2LTQC 4LVHC 4KK8D 2RBLA 1X44A 4M9PA 5DD6B 3U2SA 1I3GH 3H9YA 1JPSH 1RFDL 1BQHB 1XGPA 2PW2B 4PV9B 3LKNA 4EIZC 3VFGL 1NFDA 4NO3B 4D0DA 4H8WL 5DQJA 1MJUL 1NL0L 3HPLA 3MGOB 2W9LA 5C07D 1FC1A 3MCKA 4OFDA 2J8UB 4NQXA 3IRPX 3IXTB 1HH6A 3SCMB 3JZ7A 2QQNL 5ENWA 2EE3A 5L2KE 4QHMA 5GGUA 5CJOL 2GSGA 3DXAE 4ZS7H 5CMAA 1NGQL 4LU5L 1N6VA 1IM3B 5F7WC 1EAJA 3MFFB 4DOHB 3MLPA 3MLVH 4WJ5B 3QFJB 1MCPL 3L5WA 3MUGA 1UB5A 4HKBA 2B1HH 1WBXA 3TJHD 3V6BR 3KPSB 2APWA 2CLZB 5JMOC 4YHPA 5FHBH 5EFIB 1DN0A 5CZKA 2Y1VA 5JDJA 1YEKH 2H3NA 4OZIA 5CBEA 3F7YA 4JDZB 1R3KA 2NQCA 5C7XH 4PB9H 4HJGB 2COQA 4OFPA 1KJVA 4PV8A 4RFEA 3REWB 2VLRD 4PGEA 1EO5A 2FYYA 3PL6C 1E4WL 3BGMA 3DV4A 3F65A 2APTA 1HNGA 3VE0A 1T1ZA 4MHHI 4Y19B 1X5FA 4DEPB 1YPZF 1FJ1B 1OARH 4XCCH 4FXLA 1BOGB 3GSVA 5EULV 1S5IH 4NO0B 4LRNL 4KPHL 2FR4B 3SDYH 1CYGA 1SJHA 4TPRH 1I8MA 5ICYA 4HS6A 3BKCL 3N1QC 3V9FA 1TZIB 3V5DB 4DVRL 4NRXB 5HYJD 2XFXB 5LBSL 3KYOB 2UV3A 3UJTL 1CDCA 2J5LC 4YDJA 1KCKA 4OLEA 1JE6A 1DUYA 2NY5L 2ZOLA 1K6QH 2PTTA 1JGVL 15C8L 5FGBA 1IAIH 1R3LA 3CH8A 4MXQD 4CMHB 2EO9A 1DCLA 4GAYA 2XG5A 2MTPA 5HVHC 4BH8A 1QSZA 5F9OH 5GSRB 3OXSA 3GSWA 4R8WH 3RZCB 1RZ8B 2WW8A 1MCEA 3QQ3A 3OL2A 5JQ6H 3RZCC 5GGSA 2VDQH 1TENA 1SY6A 1NMAH 3B9KC 2IMMA 2DRUA 5HHVH 4ZFFB 4HXBL 5DRWA 4DN4L 3MMEA 5J06A 4LF3A 3GI9L 5DVNA 3LPWA 1KTLA 4JFQB 2NLJB 3H3KA 4K7PY 1FDLH 3KPMB 4PJBF 3DO7A 2E3VA 4W70A 2YD4A 1X7QA 3QQ9D 3QUXA 1MI5B 2IQAB 4EEEA 4WHTB 4AIZA 3GO1H 2V2TB 1CFQA 4XP1H 4KUZH 5ISZA 1I1RA 2QHRL 2IBZY 3NIDE 1J8HD 4B50A 2R29L 4LHUD 5FYJL 2Q8BL 4HEPG 4GRLD 5DC0A 1CT8A 2ITDB 4NQEB 3S5LB 4KJYA 3RHWK 2X1QA 4JREC 3BE1H 1LK3L 1NMBH 5DD5L 5JOFA 4ONHA 4Z7VE 4JPVH 5DQJB 4HWBH 4J8RA 4L8CA 4U1SA 2DJ4A 4IOIB 4HFWB 2KKQA 4XXCA 1A22B 1QNZH 3T0XA 4KY1H 3G6AB 2IFFH 4JZOA 3FRUB 1F97A 3OAZH 5E70A 3X3FL 1C12B 1WIPA 5FKAB 3EYSL 4NFCA 1HEZB 1AE6L 3GUTA 1FG2A 2KPNA 4GSDL 4X7CC 4XXDB 4XPBL 2EYSB 4J1UA 1SJVA 1QP1A 1F11B 1NGYA 4PJ5B 4ZDHA 1CIDA 4KMLB 4WGVB 4XVSH 2AK4D 3VFMA 2HT2D 4WFFD 1A7PH 1X4XA 4Y16C 4JKWA 1IC7L 5J7CC 1RZGA 4UNUA 2BSTA 4RQQB 1PKOA 1CXLA 4Z7WE 1PG7L 4G6MH 4PJFA 1HQ4B 4O4YH 4JPWH 5IVZB 5IUSA 5HGAB 3P40A 4M5YH 3REWA 3H7BB 3VH8B 5LCVL 3IDGA 4GRMB 4DZ8B 1CE1H 3BKMH 1B0GA 2FB4L 5E8OB 2QSCL 1HNFA 4J3OC 3P4NA 1P7QA 1MCSA 1UM4H 3PGFL 4Q6IB 4MSWA 1XGPB 1CL7L 3KPRD 3LOWA 3UX9B 2IBBA 3NAAH 1JWSB 1G84A 2ADIB 4XTRC 4N0YH 4G8EB 4HIHB 5D1QD 4P49A 4OGYH 2OX5A 4CADA 5MEQA 4DAGL 3LB6D 1Q72L 4RISH 3BZEA 5DEFA 1AQDA 2EXYD 1P69B 2M8XA 2ITCB 3V7AE 4E41E 5JOEA 1G0YR 3BDBA 2YC1A 1TTFA 4HT1H 4OGXL 4CBPA 3VFPB 4GQ9H 2GHWB 4QRPA 3I3EA 1S7VA 5DJZA 4Z7QF 4L8SC 3RUGA 5I8KH 4NNYA 1XZ0A 4F7EB 3EO1A 3HE6A 4L3ED 1NFIA 5HYSA 3QQNA 4U6YB 2H3NB 2WWKT 4FQIL 3T4YA 1NAML 4P9HH 1BD2B 5F89A 4I18B 3TJEL 1EEYB 1NCWL 4YX2H 3L3GB 2L7JA 4K55A 1YMMB 1RJYB 1XEDA 2EC8A 3LHPH 1JNLH 1SYVB 4GS7B 4LRNH 3EW3B 4WI5A 3RWCA 3VGFA 1OD9A 1X7QB 4RBPK 5BS0E 1UXWB 3S96A 1XGRA 1P84J 3VXQA 4HLZH 2PW2A 3QXDB 2BJML 3I9GH 5D6DA 3ZSSA 1AKJA 4IMLA 1FFOA 1M7DB 2FJHA 4GRWH 4IS6B 1Q0YH 4OCSL 4ZAKD 5KSVA 2Z31B 5ADOL 3P9WB 1T83A 4OKVA 3WFBH 4D0DB 5EOQL 4JZNA 3RBGA 2AJYL 4OLZL 4Z0XA 3GSNA 3BZDA 4PJAF 5E1HB 1WISA 2Q87A 4GKSB 2CKBL 4BUGA 3GNMH 4RAHA 4UV4H 2Z31C 3FQRB 1U8KA 5HXMA 4K8RL 5IF0A 4D2NA 1JIBA 4C4KO 4KGLA 3ZKNC 3D3VB 1A64A 4WW2B 3OKMA 5HD8D 1EEUA 5CBEB 2BFVL 2ZWLT 4X9FA 5EFIA 2Q76B 4YXLL 4JFFE 1FE8L 5I73C 3QIWB 4PJ8D 1YEEH 3FAWA 3RTQB 1RK1A 3X13B 3EYOB 3T8XB 5EZLB 4WUUD 4M02A 3VXNA 3GMLB 5EU5A 4FP8L 2PN5A 2AXFB 4TPRL 3V5KB 3QCUH 1DEEA 2WUCH 4JHAH 3VXUB 4G6KL 4OTXL 4JFFA 1TJGL 4Q6IA 5IFHH 1U6AH 3LIZH 4G7YL 2EIDA 4PJ9D 3ULUF 1XIWC 3S35H 2ZG2A 4JM2A 3LV3A 3O9WC 3CFCH 2JB5H 3MX0A 1JF5A 2IC2A 2VIRB 1BIIA 2RFXB 4XMKH 3S4SG 4JG0H 3L3DB 1NKRA 5CWSB 1QBLH 4GXUN 2VSDA 1GC1C 4IRZH 4P5TC 1C16B 1CICD 1FN4A 4HXBH 1UA6L 2J2ZA 3U46B 4YFEA 3PXHA 2JCCE 2IH3A 5EBGA 4QT5A 4FABH 3K3QA 5ALCH 3GUTB 3GIVB 1KG0B 4NHUB 1F58H 3PQYB 1MH5B 3T65B 3U7YH 5C0GA 1K8IA 4LK4A 4O4YL 3MLRL 5A3IC 4HXAL 4G9DA 1HKLH 4G80B 2Y4SA 1ZLSL 3ECBA 3MRMB 2BHZA 2Q7YA 4YZFF 1GAFL 1TXKA 3MODH 3UC0H 4LCCC 1ZA6B 2WQRA 3NPSC 6CGTA 3D2UB 5HYEA 4FQHB 3IETA 4WVRA 4HZLB 3BN9C 4Q0XH 1VENA 2MMXA 4H5SA 3P0YL 4OM1H 4K2UH 4PJXF 1F13A 5GS0C 3LCYA 4KRMB 1EHXA 4Y16B 1T20A 1PAMA 1QNZL 4QY8B 4YE4H 4L8DB 5J1AA 2B39A 5K9JH 4NQEA 4OZFB 4GQ9L 2BCKA 2OR9H 3S37X 1V8HA 4Y7MA 1OAYL 2YN5A 3OJDA 1YEHH 3EJZD 5SX5H 5JLZB 2XA8H 3W39A 4NO2B 4NDMB 5ID0B 5KVMC 2ZSVB 3GSNB 1LE5B 5GGRB 1J12A 4TNVF 3QRFM 3RVVD 1P6FA 1FL5B 1J9CT 3CC5B 3OKLB 3ZKMD 5INDB 1LP9F 4R3SA 2YXMA 1PGRB 4GG6B 1NPUA 2C1PB 3PHOA 1JVKA 3O2DL 1D5BA 1UXSB 2R2HA 5DK3A 4DUVA 1CE1L 1IKFH 1HHHA 3BKML 1A7NH 4XPGH 4ZUWA 2GEEA 3SOBL 2F54E 5I8EB 4MVBC 5HPOA 3FQUB 4PJAB 3REVB 1MLBB 3RWEB 3PHSA 4YBLB 4CVXA 5FECA 1MRDL 4U3HA 5FOBA 1AXTH 3WFZA 1CWVA 1JWSA 1I9EA 2DBLL 7FABH 4IMLB 3PHQB 4HMDA 4QXUH 3MLTB 3VXUA 1W72A 4TRPL 3DRTB 4EUPH 4KXZI 3PDOA 1IT9H 5AG8A 3SY0A 4WO4C 2QADD 2FGZA 1R24A 4Y2DC 5JHDB 1JGDA 1T4KB 3DXAA 3BZ4B 3HI6L 4JKPL 4KRPD 5CJXC 5L2KA 3STZB 2EKSA 2D7OA 3U82B 5LAXB 4JM2F 2ADGA 2SEBA 1SY6H 3MRKB 4QEGA 1TTGA 5IB5A 4U6TA 4N8VB 2VR9A 3BEVB 3IXAB 1K2DA 1N64H 2EECA 3OR6B 1XF4B 1A3RH 1S78D 3HZMB 1UZ8B 1W72H 4ZUUB 4U1GC 2A83A 3BJLA 1NCNA 4QT5B 3J7HA 4EBQL 2YUXA 5DZOA 1B0RB 4LLVB 1MCKA 1BFVH 3LMJL 5FGBC 3MV9A 3T0VA 1UEYA 1PQZA 2ESVB 5E99H 2E9WA 5C0IA 4OD3L 3WXWL 5ISZE 4DEPC 1SBBA 4YR6A 2YWYA 3UPRB 4RZCB 3GMLA 1L9MA 1YY8A 1YMMA 1I3GL 4U1GB 4JKLA 5AUMA 2ZUYA 3QDME 2Y07L 3S35L 1I4FA 2VLMD 3H9HA 4D8PB 4KWUA 4PTTA 2HN7B 5JIIA 1IGFL 1LD9B 4O02L 3L7FB 1FO0L 4QGYA 2P24A 3NIFE 1FFNA 1SVZA 3O6LL 1KLGB 3EOBB 1S9XB 4JZNB 3X3GL 25C8H 4MNQD 1U3HD 5T1LD 2H32B 1QOKA 3HC3L 2ZCLL 3E6FB 3BO8B 1JYXA 1Z6JT 3TCLA 1FORL 2NY5H 3DYMA 4F15C 1XF3B 2D03H 5JUEL 3LKPB 3C5ZC 1JZ8A 5BV7L 4ZS7L 3S36X 1RURH 5ADPH 4KI1A 4HMEA 2A6IB 3TT1H 2LVEA 1KENH 4EOWH 1C16A 4MCZB 4NC1E 1BBDL 4D0BA 4K3DL 1MCHA 4XC1H 1U3HB 3FOMB 5SWZB 3TA3C 1KPRB 5ILTL 5B22A 1KG0A 3SDAA 4PGBA 5DEGA 3UTOA 2NZIA 3TN0A 1A1NB 4CUCA 1INEH 3DGCR 4MAUH 4NKQB 3BP5B 4PB9L 3PWNA 3U0WL 4RMRA 5DTFB 1CGSL 3GRWL 4C83B 2ICES 3RJDA 4BH7A 4Q0XL 1PYWB 1S8DA 2JIXD 5D9SB 2X4SB 4RGND 4HUXB 4M3KB 1JWUA 3D9AH 1FZMB 4LVHB 5D1ZC 1AI1L 2Y9RT 5EU6D 4QTHB 4OF3A 2WUBL 1RZKC 1OL0A 3ARBA 2H2SC 4YAQA 1IC4L 3GGWB 5FYKL 1YUHB 4KKLD 1N8ZB 5JNYB 1MFCL 3TFKC 1KB5A 3FO2B 3WFDH 4X7FC 3IU3A 1IC5L 4ZYKB 1MCFA 2ERJB 1I3RA 5CJQH 1LE9A 3EO0A 5C3LD 3KS0H 1QEWA 3VWKC 1DQTA 2JTDA 2GUOA 4PJ9C 4LSUL 3WNNA 5IFAH 1QLRB 2OZ4L 3HA0A 4M03A 2BVTA 4HF5L 5F9WC 5GHWL 4JRYB 4ZXBA 1I1YB 2HRPH 5CAYB 5T1MB 4J3WA 3KG5A 4NIKB 3RUGB 4PS4H 1XF2B 3BPLB 4EDXA 4PREA 3EYVB 2M1KA 2R8SH 5CKAA 4JFPA 3EYQD 5MEPB 1WTLA 4NKOB 1J1PL 1M7XA 3MFFA 4JFDE 2AJZA 1WBYA 4Q6YA 4YHYB 5C0RH 4JDVA 5EIVA 2PETA 4P5MA 1L0XA 2XYCA 3AREB 4G9DB 2J12B 1QRNA 3RKDD 2EZ0D 1MJ8L 1P9MC 4WTXA 2HFTA 3KLAB 1F4AA 3MRIB 1N4XL 3B2VL 2FLBT 4YHOH 4OM1L 4K2UL 5DI8B 4MQXC 1AH1A 4CNIA 2QQKH 1ZS8A 4U1JA 1OB1A 3CFDA 2XWBB 3C8KB 3RTQD 3I6GB 2FJHB 5LWYL 5E08L 3ZYIA 4WEMB 5CILH 3NCEB 2DQTL 3MV9E 3D39A 2QQQA 3AU1B 2MHAA 2PXYC 3BIAX 4XBGA 2DM2A 5FYKE 1NBYA 4X80H 2GTZA 1T21A 1NCCH 3O11B 1OGTB 3EJYC 4Y4KB 4IRSC 3GDBA 4Z78A 5TQ2L 3RZWA 4GKZB 2W9EL 4F33A 1P4IH 1ORSA 2YA0A 4NOFA 3SQBA 5DRXA 2FJGB 2NW3B 1KYOK 4UOW1 5CS7A 3RNKB 3V6OA 1ES0B 1KN2L 2DKMA 4E41D 3IFPA 5IEHB 2VLJA 4KTEH 3SGJC 4HS8L 5DT1H 1MRCH 1ZHBB 4IRSD 4OZHB 3ARZA 3ARQA 3OKMB 1A14H 1AXIB 1K4CA 2ED8A 3WFEH 1JFQH 3Q48A 4QRTA 4D0CA 1I1CA 5MEND 5F7EL 5CEYA 4CU6A 1D9KB 2B0SH 1ZT4A 3QJFA 3H9SE 4MXVE 1C08A 3LS4H 4LCWB 4Z7OE 1FFQA 1TIUA 3BW9B 3LQAL 4NQDB 4IIQB 4MAYA 2DQDH 4ZFFA 1NC4A 4LLAA 4MX7A 2BRRH 5B8CA 3CVIH 4PLJC 1DN2A 5CSZA 1QSEA 5HPMB 1MAKA 2BNQB 1C7SA 1NCBL 5FDWB 3ZE0E 3LS5H 3AROA 3PWPA 1TCRB 5F7FA 3U36B 2ENYA 2F54A 2J7LA 3GBNL 1KYOJ 3EIFA 3SN6N 5F9JB 1XR8A 4DKEL 3PL6D 4HUWB 4FXKB 4WHYG 4RGMC 4A2MA 5JPMA 4U7MA 1NGWA 3N0PB 5F7NC 4JQXA 3ET9F 1S9WA 2D4DA 2ITDA 4MVBD 5E8DH 2XA3A 3ZZ1A 1S7RB 3VMOA 2W92A 5LGJB 3ZTJG 1J8HA 3NGBC 1DTUA 3GNML 1VA9A 3ARVA 4NRYB 3FT4B 3DSNA 2OQJB 2IH1A 2SEBB 5HI3C 4AZ8A 3MJGX 2W91A 2CXGA 3PUCA 1EAPB 4Q6IC 1OPGH 2VUOA 3HZMA 5ITFB 3O6ML 3CGTA 1K2DB 4PLKD 5K9KB 1GC1H 1R5IA 1U8HA 2J88L 3DX6A 4GS7C 5HGDA 4RDQG 3LKSB 4OBSA 4L5FH 1N7ML 4GOSA 1R3IL 4YK4B 3IFOA 5HYSG 1DZBA 1IC4H 1N2RA 1J18A 3DV6B 4YEFA 4LARL 4LVOC 2L0DA 3QIWD 5C08A 3W9DB 1XCTA 5CIPA 1FZKA 3RI5F 4EI5C 1UB6A 4RZCA 4LMQE 1N3NA 1PZUB 3TC9A 3BHBA 3NCYP 2NXYB 4V1DD 5CJQL 2HN7A 4XNQB 1FORH 5LGHL 4P3DA 3HI1A 1NSNL 2WINB 1I4FB 3H9HB 3QFDA 4HJ0D 4KK8C 1OAKH 5EWIH 3QT2A 1GJIA 3P4NB 1JZ3A 1U91A 3WHXB 2NY1B 5MEOA 4E0RB 3DX8A 1T1WB 4ZAKA 1OAQH 4FQXD 1XF3A 2HT4D 1UENA 1FNEB 4RGNC 2H32A 4GW4A 1OP5K 4JKMA 4JY6B 1U36A 1CGYA 4JFOA 4TQEH 4OCMC 2V6HA 5FYLE 4JREB 4X8JA 3MOAL 3RGVA 5FUOL 3Q2CA 2WIIA 4HWBA 3HR5B 2HTKC 4ZO8A 1B3JA 4F3FA 2YBRB 3BAEH 4L4TA 4WRLA 2ADFL 4A6YA 2FATL 3DUSB 5CHNB 2Y7QA 1EERB 1YEGH 4HKJA 4JVWA 5HGGS 1WLHA 2YA1A 5JA8B 3O6KL 2E7LA 1BM3L 3NIDF 1CFTA 4OCWL 4MNQE 2GJ6A 5GGQH 1A7OL 1KXQE 3CFJB 4LDOB 5TPWH 2NLJA 1VACA 3VG0L 3WBDA 4OCRL 4P5MB 2Q8AL 4NT6A 3BP5A 3NA9L 1Z0NA 1MHPH 5DMIH 3KLSA 1RI8A 4ZUSA 4OUUB 5EZOH 1A5FL 4O9HH 4NZUL 4WHTA 4PRHE 5DFVD 4X80L 4CVUA 5TDOA 2MNUA 5E2VL 4M93B 3LB6C 1A6WH 3M45A 2ESVD 1P4LA 2IAMC 4NO5B 5FA4A 3JV5A 3S6CA 2ATPA 3IDUA 4QLRA 1RZ7L 3ZYZA 3ARDB 1MHHB 2P5WE 1GGCH 3VMPA 3IS0X 1YNTB 2FSEA 2X2YA 4NN7B 5M7QA 2D0HA 2WLZA 1AHWC 1JGDB 1T4KA 3P30L 3EO0B 4R7DB 1J0ZA 5EU7C 2KQMA 5C09D 2HMID 1WEJL 3RVWC 4XWGH 3NZ8B 4FXKA 5DS8B 4ZPTA 1RZIA 3EYFA 3V95A 4LL9A 4J3UA 5T33L 3W5MA 1O0VA 4OUOA 3BEVA 2HFFA 5I2IB 4HC1A 3ARBC 2C26A 4Y4FB 3RWHB 1FIEA 2Z8SA 2R0KH 2VKWA 2Y72A 2ZOLB 4OAWB 3IDMB 1XF5A 3WIHL 1QHOA 4AG4L 1GSMA 1UH2A 2XT1B 1QFUH 3L3JA 2EDWA 1UC6A 1NJ9B 1RZ8A 2X4PB 3O2DH 5C0EA 1HKLL 1EAPA 4R4FH 4OLVL 1JHKH 4ODXA 2YWZA 4MQ7A 1OQXA 3MV9B 1YN7B 3U4AA 1QTYT 4L1HA 4ODVH 3U48A 1KPUB 1AFVL 3VJ6B 3TBTB 3KNBA 3VXMD 5IJKC 3RL1A 1BLNB 4HC1L 4JDVB 5ERWA 1NCDL 3WCYA 4MGXA 5EO0B 2DBJA 2I07B 1DQJA 4NGHH 4ZPVA 5E08H 5JW4R 5M94B 1J86A 1RIHL 5DJCB 4AT6A 3TCXA 4PG9B 1CICB 2Y5TA 4RMWA 1FVDB 3D6GA 3HRZA 4N0UB 1KB5L 1FRGH 4XP9L 4PJBB 4G7VL 3FQNB 4Z9KB 5AYQA 5CSGA 4ELKB 3JTSA 2DOCA 5HVHB 3NH7H 1OGAA 1FLTX 1JUFA 3BP4A 4F7CA 5D7IA 5HHXL 5K59E 5CZVH 3QNYB 3MJ7A 1DEDA 1EFXD 2VITB 1KJMB 3LKPA 3G6JE 3HZKB 5A2IH 1HCVA 4DFHA 1ZEAL 4NUGH 3S5LA 4ZTOL 1RUKH 4UT6L 4PJ7E 3DX8B 3RUGE 4NWUL 5IT2H 2VABA 4G8GE 4NQCE 4HBCH 4CN1A 4JQXC 5C0FA 1DBAH 2ICWJ 3HI5H 5D96B 1N64L 5FK9B 4RMQA 4FFYL 2X4RA 1U2CA 2D3VA 5I75C 3QUYC 5FFLA 4LHQB 2VZ3A 5C2BL 3SDAB 3ABZA 2DQIL 1WBXB 3KYNA 4YHZH 4E41A 4G6JL 4NZRL 1H5BA 4AENA 3RVVC 2KZWA 3SDYL 3CIQA 3U46A 3UZVB 3RGHA 3KYKH 4J3TA 3GKZA 2IG2H 1XF1A 2QQLH 4PJ5A 4HD9A 1C08B 3RAJH 5E8PB 3DROA 3T2QA 2N7AA 3JXAA 1Q9LB 2FIKA 2NTFB 4TVSa 5TE4L 3G6DH 5L2KD 3QJHB 5HVWA 3HRPA 4AL8H 2VNCA 4R2GD 2A6KA 5EZLA 4POZC 3C60D 4YO0A 2O61A 1ZA6A 4YPJA 4NNPH 4U1MB 1W8OA 2IPUG 4DK6A 4Z7WA 2WINA 4TQEL 4GQPH 3VD4A 2AGJH 3T0EE 3VWKD 3CFBB 1Y0LB 3SCMC 3C9NA 2AK1L 3VWJD 5AZ2H 1H15A 4JFXA 4FQLL 3VRIB 3VFNB 1QA9A 2J6EL 2VLRE 4KKLC 5BJTB 5DA0B 1M71A 1NFDF 4XMPH 4MDJA 1SQ2N 4X4ME 3VXRE 2F9BT 1P6AB 1O7SA 3TVMC 4F9PA 3M1BA 2DWDB 3O41B 2PYFB 3BSZL 4ZSOE 3P73A 2NY0D 3TNMB 5IB3A 3IGAA 4JFPB 3RGVD 5IQ9A 3QISA 2XWJB 4HPYL 5EUOA 2W65A 4NQCB 3BWUC 5BCAA 4PFEA 4PJ7B 3VWKA 1W0WB 1NMBL 5DD5H 5JO5A 2UYLA 1JZ2A 5DK2A 5I6XB 2PYED 3C09B 4S1RH 1QACA 3OMZA 2F5BL 1S7SB 1YDPA 4K3HA 2NY2D 4KV5E 5EB9A 3WIHA 1E4KC 5C08B 2A77L 2X4UB 2DLGA 1S7XA 4OUUA 4PRPB 2Y07H 1KCRL 3DRQB 5E9DA 4WENB 4X4XA 1KC5L 5D1QC 1WFUA 1OTSD 4R90H 1CGWA 1MSPA 3TVMD 3D85D 1NAMB 2VDQL 1KCUL 2ATPB 2M26A 4RAVB 1GOHA 1EXUA 2XN9A 1WCQA 3P4OA 5HHVL 3T77B 3QEQD 4BZ1L 1RVFL 3GMRA 1TZGL 5L88L 3LZFH 2BY2A 3PDDA 3MREB 2WZPD 3S7GA 5JW4Q 1CR9H 4DKFH 4HG4K 2W38A 4YDKH 3FO0H 2IPTL 5J1AB 4NQSA 5JDSB 3BZFA 4KJWC 5EOTB 4MNGA 3D18A 4KROB 3C8HA 3LH2H 2VR5A 3OB0H 5IB2A 4OF6A 5KSAC 3IDXH 3V52L 4RWHA 4MS8C 5E2UL 4I4WA 5ENWB 4S1DC 3KDMB 4F80A 2VAAA 1YEIH 2R0LL 4Y4HB 1AFVH 4AEIL 5KVEH 5JHDE 3GSOB 1ORQA 4ZAKC 2DLHA 4UBDD 5E24E 3SGDI 2D9QB 2XTJB 4GRWE 3C6LB 1M4KA 5D1XB 5I1DB 2W59A 1T80A 3JUZA 4J12A 1NLBH 4GW1A 5KSBF 2NY7H 3HS0B 2CKBB 1U95A 4Y4KD 1C1EL 2VC2L 4OM0H 3AXLA 3MBXL 4I48B 2JK5B 4QCIA 2VXVH 5HPMA 2R56L 1CFNB 1JRHL 2AEQL 2VISA 1ZWIA 1B4JH 4IOFC 4LQFL 3RWJB 3SEPA 1NMCB 4L3CB 1NDGB 3OZ9H 2AABH 4RBPH 5MHSD 1E27A 5CJ5A 1ROWA 3UJIH 1Y6NR 4JJ5B 1KFAH 4R97C 3TEUA 4O2FA 3DX9B 3N85H 1MFCH 4IMKA 5HYQA 2BXZA 4PRHB 1IGCH 2NY1C 2PCPA 4PG2A 1IJ9A 3NCCB 5B38B 4BJLA 2V9QA 1V3JA 5I8OL 4U1MA 2C5DC 4RRPA 1GVIA 4UT9H 3VXTB 1FO0B 5L0QB 3ZE1F 3MGTB 2UWEB 2QADC 4WTZG 1ND0A 4N1CA 4PJHF 3RY6A 3MA9H 3SE9H 5C2BH 3A6BH 4JEGB 1QR4A 3C87A 5IMLA 4LVOB 1IEHA 1HSBB 4R4FL 4PY7B 5DZLA 5BJTA 2WSKA 2J6EA 4JJHA 5EPMA 5BZDA 5IV2A 4YUEH 2P8PA 4FXGA 1J1PH 4P2YA 4WTZA 1S7UA 5ADOH 5J13C 1L7TL 1BP3B 1WWBX 5GRZA 2DYPB 3DIFA 1JYVA 1YYLL 4S1DD 3HZYA 4HIXH 4NN6B 3TBTA 1CLOL 5DK2B 1HXYB 5LXGL 4U3XA 1XGYL 1ZANL 1KT2A 2Q1EA 3QH3B 5ESVA 4HX1A 2VXTL 4G8GD 1XCQA 3OKDA 4NQCD 3QUMH 5BMFL 1IILE 2WQ8A 4M5ZH 1FZOB 4CKVX 4ELME 2IQAA 1YECL 2DLFH 3CUPA 5BXFA 4U1KA 2PTVA 1WCBB 3A6CH 3QNXB 4ZTOH 1OGAB 5IWLA 4JRWA 1RK0B 5J12C 4QTHA 3MLVL 1JNNH 4EN3B 5C70A 3HI5L 3FOLB 1U92B 4JZJC 2WNGA 4JY6A 3SKJL 3QZWG 1OAUL 4JO2L 3IAQA 5ACZB 4I2XA 1E28A 4IOSD 5EUOE 3NACH 3BH9A 3HCVA 2X44D 1PW3A 4Z0BL 5GGVY 3LQZB 1CBVH 3D0VB 3KS0J 2YD3A 5DT1L 4OZGB 3VD7A 3S37L 4EDWL 4YHNA 3BPNC 4IIQC 4X6CB 5KZCB 5JW5B 4PLOB 5F3BB 3G04A 4ZD3H 4OCLC 4BZYA 5DR5L 5F7LB 4AENB 3HUJB 5FO9A 5EUOB 4EI5D 4XNMB 4LSSH 1FL5A 1S9VA 3KYNB 5SWSE 3RQ3A 4X6BA 1EGJA 3MXVH 3DBXA 5GS3A 5E8EA 3CFCL 2AJYH 1G9ML 4N8VG 3MRPA 5E8PA 1EFXB 2JJTC 3MA7B 4LVNB 3UJJL 1RUQH 3MV7D 3VXUE 1BMGA 2OP4H 2R2HB 3GSNL 4EVNA 3WSQL 1CU4L 4ZTPH 1DANU 5C0ND 5I17A 3RDTC 2QLVB 2BHUA 3BD5A 3DRQA 4I77H 5I8EA 5C08D 4ELMB 4XI5C 1CFNA 2VISB 1W0YT 4JFHD 1MCNA 3EFFA 3HNSH 1MNUL 4PTTB 5C07A 1D6EA 5GXBB 1P7QB 4B7IA 3WFCH 4DGYH 5C6TL 3QUZC 4WW1B 4KXZH 1WV7T 5HDQH 4U2ZA 4U6VH 3QUKA 2Z93B 3CX2A 1N0LA 1II4E 3MLUH 3GI9H 3MACL 3FQWA 4BFIA 4D9RD 1U8QB 5DRNB 1IAMA 3IDMA 4FHBD 3VCLB 2HLAA 5DQ9B 1EDQA 1XR9A 1EEQA 5D2LB 4HIIB 2PNDA 3BVNA 5DDHB 3PQYA 2DM3A 2W9DL 4P9MH 4PR5B 3OG4B 1T66C 3JWNC 4CAGA 2ADJB 4PRNB 4LKCA 5JZ7C 3ESUF 1S9KC 3QA3B 2OJEA 5IHBA 4G9FE 5HHNA 3QUYD 1VEMA 1JPFA 1U95B 2VE6A 5JOPD 3LN9A 4JRXA 4XHJC 3QJFB 4QHKJ 4S0SD 5EOCH 1JJUA 1SYSA 4MD0A 1ZLUK 3O8XD 3C2AH 3RVXC 5C0IB 3BGMB 3QH3A