1A0QH

29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
216
structure length
205
Chain Sequence
b'VQLQESDAELVKPGASVKISCKASGYTFTDHVIHWVKQKPEQGLEWIGYISPGNGDIKYNEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYLCKRGYYVDYWGQGTTLTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 29G11 FAB (LIGHT CHAIN)
publication title A comparison of the crystallographic structures of two catalytic antibodies with esterase activity.
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 42
structure length 205
sequence length 216
ec nomenclature
pdb deposition date 1997-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a0qH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a0qH02
3ARBB 1LO4H 1JYWA 3RDTC 3I50H 1AP2B 2O5YH 3TYFA 1P69B 4WW2C 5I1AA 4MA7H 2B2XL 3BZ4B 2N4IA 2VQTA 3O4LA 5I15L 1AD9B 3ZKNC 3DARA 4PJ7F 4LLVB 1RUQL 3VXMA 2V7HB 4P59L 4UILH 4WUUD 4ERSL 5DJ8A 3RVVC 3WBDA 1G9NL 3ZDYF 1CLYH 1YEHL 1T66D 5AEAA 4Z95L 4EBQH 4URTB 4HPOH 3OHXB 3F7YA 4WHTA 4EUPA 4X6EB 3ULVH 2BRQA 2IBZX 3X3GH 3MA9L 1Y18A 4ZFFA 4GKZA 4YC2B 3GSUA 5TE6H 2VISA 1CLCA 1W0WB 2D31B 4PJ5E 2YWYA 3LKNA 5HHOA 4AEIL 1RULL 1TETL 2ATPA 4U6HA 2G60H 5TH2B 1F6LL 4KKLD 1C16A 3RGVC 5I1GH 1RI8A 1JWUB 4JM2F 1NUNB 2ICCA 2EIZB 3FAWA 3TCLA 3VFTB 1I1AC 4KY1H 4I2XA 5T3XL 1HH9B 2EDFA 3KYOA 5HJ3B 5I66A 2HRPH 4LCCC 2X6MA 1TMCB 1B0GB 2ZOLB 4OZIE 2XKUA 3RWCA 5I8EA 5CJOL 2IH1B 3WXWL 4NC2B 3CXHJ 1R5VB 1RZFL 2PYED 5C2BL 1ND0A 3QPQD 4UV7H 3PP3H 1YEFL 2MFNA 1NMBH 2O5ZH 5C0RL 2J3SA 5F21B 2XWTA 3P77B 1TTUA 4WW2F 1UQSA 2W59A 1NC4A 1YEEH 5A2LH 3WIFB 2EH7L 4HUWB 3AB0B 3BP6B 1JWSB 1OPGL 3T65A 5JIPA 4MX7A 4ODUA 2MHAB 1UVQB 3C9NB 4NNYA 2WNGA 3SBWA 3KGRA 2Z31C 4K8RH 5AYQA 4KQ4H 3UTZB 4CNIB 5BS0B 5IMLB 1ZHKB 1S9WB 4O2FA 1ONQA 3PP4H 1HHKB 5FB8B 5CP3H 2XKNB 4F8TA 3MLRH 4YWGH 3TWCH 5D72L 1DVFA 3NCCB 3QJFB 12E8L 3F12B 3VXSE 4FFWC 2YHGA 4PJHA 1J1PL 2Y5TA 4GXVL 2Q8AL 5EBWB 1RMFL 2J1KA 5MHSD 4KRLB 3N1PC 2NY7H 1NEZB 5ESQB 3HR5A 4I18A 4I77L 4U49A 3QRGL 3EFFA 4AH2B 4F37F 4PB0H 2BVYA 2H2SC 4P4KA 4PRHD 3VXUD 1LMKA 5IHZB 2BNUA 3ARBD 4G8FB 2CUHA 2FLRT 4TPRL 2P8PB 2A1WH 3TT1H 3SDDB 1WUNT 1S7TB 2VNCA 2F5BH 5HYSA 3SE3A 3UXFA 1B0RB 3O0RL 3PL6A 1N4XH 1FZMA 1N3NA 1TQBB 4KHXH 3S6CA 1AXIB 1A7NH 4MB3A 4WCYL 1HQ4A 1IGMH 3RTQC 4NZRH 4ZFGH 1ZHBA 5HPOA 5J89A 4G6JH 1FYTE 1OP5H 5ABDE 5D6DC 2NYYC 4WY7L 2C9AA 2CDEA 1F11B 4N0RA 3GMNA 3KPMB 2FO1A 4KKCC 4C83B 1F3JB 1SJHB 3VDBA 1TXKA 2YRLA 5EIVA 4JRYD 2F74A 2QADB 4DVBB 5HI5D 1INEL 1S7UB 1A14H 5D1ZA 5HYIA 3T1FA 1LD9B 4N9OB 5ICZB 3QISA 1RUML 3VFNA 1Z9MA 1XGUA 5IEHB 3WDIA 1ZSDA 4F7MB 5JPMA 3IXTA 4MXWL 2NR6D 2O26U 3T04D 3ARPA 3U79A 5LGKA 3U4BL 1K5NA 3GRWA 5AYUL 2J4WL 1NL0H 4KRMB 3DO3A 4WHYH 5F3BA 4OGAD 4XCYB 1YEKL 3R4DA 1QFWH 2R0KL 5A3ID 3TF7C 1YZZA 4GAYB 4JRXA 1BHGA 3GSWA 4JPIA 1BQUA 2DWDB 2XYCA 3VA6A 3ZKMD 1YJDC 4BZ2L 1I9JL 2BP3A 3MUHL 4S0TD 1BEYH 1UZ8A 3IETA 5K59F 5GZOD 5D70L 4NQCA 1AGDB 1CLZL 2Z93A 3DXAA 1XH3B 2CIIA 5BS0D 3OSKA 3EDJA 1F4YL 4LHUA 3MLPA 4HC1L 4X99A 4JEGB 1MWAH 2ZCHL 4HKBA 3FTGA 3W0WD 1JI1A 3U0TB 4PJXE 1MY5A 2VDRH 5MI0C 2ZP0T 2VSDA 3DUSB 3SEPA 3V6FA 5L9DL 2C26A 1YMMA 4R4ND 3IKCB 4CN6A 1KC5L 5E6IB 1L0XA 4MCYA 3S5LG 4ZPVB 3CXHK 3RIFK 1SVZA 4YIQA 5IQ7H 5D5MB 3FONA 4V1DA 2NY3B 5EZLB 5IM7B 2H9GB 1RZKC 3DTXB 5CGYC 2NY0D 3OAUH 1AFVL 3I6LD 3H42L 1B0WA 4HLZH 3TZVA 1YY8B 1IAII 2VDPL 2LQRA 4IIQA 4AM0A 1H0DA 5JQHC 1QHOA 1MCIA 3IDGB 3HZVB 3QUML 5MEOA 4DW2L 1I3RB 2CKNA 5FYKH 3O6MH 1ZV5A 2OR8A 3HNVL 5FKAB 2V17L 1G6RB 1CR9H 5ICXA 1Z3GH 5E4IA 5HBBA 1G7LB 5BV7H 3ZHKA 2CR6A 4R8WH 4S1SH 1I75A 4FNLH 1DBBH 4B41A 2HYMA 4I3RH 4DK6A 5DD3H 2H2PD 2E3VA 1C08B 4PY7B 2EKSA 4JR9H 5CMAA 5GS3A 2FSEA 1N7MH 4AY0A 3TIEA 2WWKT 2IFGA 2VRAA 3U1SL 4MXVF 4FFZL 1KIQB 4X4YA 3NCMA 5MEND 4G8GE 1VENA 5I1JH 3LHPH 1CDYA 4Q9BA 1EFXA 4U6TA 4M6AA 5F7DB 1LNUA 3HMXL 4KK6C 3MPCA 1ED3A 3IU3A 5J12C 1NFIB 2V5YA 2QADD 1KCKA 2X89A 3HPJA 1M4KA 4JFXB 3SKNA 1WZ1H 4AENB 1NANI 1ZGLM 3DRTA 4G8EB 4NOBA 5A2IH 1RVFL 4XPBL 4IRZH 1MRCH 4W70A 5D7JD 5DD6A 2JCCF 2DM4A 3NAAH 3WN5A 2OTUA 4MMXC 4EDXB 4Y5VB 4FG6C 3KS0H 4HJJH 3BUTA 4NKMB 5C0AB 1JF5A 1T21A 2D7MA 1NJ9A 1MHEA 4FQHB 3OJ2C 2ARJQ 1XIWA 1N26A 1YYLH 4P9HH 5DK3A 1WT5A 2K7PA 2A9NH 1PG7L 5HGAA 4AL8H 3FQUA 3WLWC 1BGXH 1Y6KR 5CD3B 2JB6B 5FO8A 1YY9D 5KVGH 4ELKB 3MV9A 4X98B 1LEKA 3SDXB 1WEJH 3V95A 3MRKA 4JVWA 5IQ9A 2NTFB 2UVEA 1RZ7H 4FZEH 2NXYB 3CH8A 3O9WA 3H3PH 5EZIH 3SKJH 4KI1A 3QUYD 5IB2B 5E5UB 4Q2ZA 3V5HB 3QCTH 1OSZA 2R1WA 2HVKA 4P57B 4PJAB 2VL5A 3OXRB 2YRZA 3KLAB 1NUGA 1JK8A 3W2DH 1CE6B 1E6OH 5IWLA 1FZKB 3VDCA 4Q9QL 4PGDB 4AEHH 1JRHI 2W1NA 4PGEA 1DBML 1N5YL 4NQED 1FNAA 3QJHA 3LDBB 2CDFB 1RD6A 3PWUA 4P2QD 1BOYA 3NCFB 3U9UA 3MLVL 3WJLA 1FL3B 2IPUG 5K9KA 5KSBF 2OS7A 3QUXC 4XI5D 3BKMH 3BPCA 4YAQB 3FQXB 4RGND 4Y4FB 4N0YL 1GAFH 2VC2H 4XP5H 4GW5A 4MCZB 2FB4L 3MLSH 3DECA 4O51B 1HNFA 1X6NA 4NZUH 1VCAA 4NNXA 1U6AL 4Q6IC 2IANA 1OAZL 1KCSH 1JPGB 4DFHA 4U3XA 4POYA 2WUBH 1JRHL 1NLDH 5C2UB 5ISZE 2YUVA 4Z77A 4Z7UA 3SE9H 5CGMA 2YD9A 4LFHG 1AR2A 4ODXA 4WTWA 1N59B 2XZCH 5ITBH 2GJ6B 4GQPH 3B43A 3C5SA 2YK1H 2DQUL 3B2UD 4CJ1A 3RNQA 5LWYL 4Z7NE 3ARYA 3GSRB 3JUZA 4KK5D 1X5LA 5GJTL 2XG5A 1VESA 3TFKD 3VFVB 3PWVA 4M4RA 2M2DA 5GPRA 1U91B 4OFKA 1P4IH 1HDMB 1NFDA 3KDMA 4HWNA 4TSAH 3P0YL 1WCBB 1YQ2A 1S8DA 1HSBA 4LKXB 3H9SA 3LKRA 1QNZH 5DQDL 5CEZL 1J0KA 4HK3J 1U2CA 2YD3A 4PTUA 3RBSA 2J8UA 3U36B 4UU9A 2FR4B 5F89B 4O02L 4J1UB 3PWLB 1AJ7L 1FORH 5D96C 1PG7X 5A2FA 3MXWL 1SEQH 4K55A 4NO2B 4OQTL 2JTDA 4J3TA 4ZO8A 4UV4L 3PP3K 2H41A 2DIBA 2VDML 3HG1E 3VWJD 2X1PA 1NAML 1RFDL 5GGUA 5T1KB 3SDAA 1MFEH 3P30L 4X6BB 3TO4D 1OTUC 5FKPA 4M5ZL 4KGJA 1UEMA 4QF1B 2ERJB 4FRWA 4FA8A 3P40A 4HF5H 4N5UA 1EPFA 4S1DD 1D5BA 3OZ9H 2JJWA 4JY6A 5DR5L 5IHUH 5TE4H 3ARVA 1E27B 3WNOA 2IG2H 4TSCL 3V0VA 5JHDA 4D9RE 3O3BB 1LO5B 2ZUTA 3L5XL 5EIIB 1TQCB 4X80H 1IEAB 1DQQA 3ARBC 3SOBH 3O4OB 5EZJA 3X14B 4C56E 4ONHB 1NEZG 5K9QG 2GITA 1GGIL 3IYLW 4HGKC 5I16A 3MLZL 1FO0B 4LP5A 2A9MH 1LEIB 3WUWA 4HGWB 3BI9X 3F7RA 4MQXD 4GO6B 1DQDH 3U6RB 2QSCL 1OW0C 4LDOB 2GEEA 3ARDB 3C08H 1IZJA 3UTTB 1WFUA 2OJZL 4LMQI 3AC0A 3BKCH 2IQ9L 2Q7YA 3DVNB 3PGDA 1FZJB 1A7RL 1U42A 4RAHA 4K2UH 4UT6H 5CZXD 4NFDA 3D69A 1XR8A 2JB5H 1KJ2H 4JVUA 2A73A 1MLBA 2ADJA 5EOTA 5J7CC 2BRRH 5CZVL 4I13B 3GNMH 3S3PA 3ZTNL 5HI5C 3KS0J 1EXUA 5HHOD 4DKAA 1I1FB 2HFEA 3QNXB 4HKZA 5DUPH 3OAZH 1JTOA 4F3FB 3MLWH 1QFPA 1AGCA 4ONFL 3ARGB 1UYWL 5FYKU 1UA6L 1HYSD 2APVA 2VQ1B 3L3GB 2GIYA 4UUJB 1OP5K 2AEIT 3VH8A 5C9KA 4H88L 4ZUSA 4JFZH 2D7NA 3TNMB 4OGAC 1EAJA 5E08L 1LO0H 5A3IC 4HWEL 4YHIB 2EDTA 1YEDA 1YJDH 3LD8B 4HBCH 1YMHA 4FXKB 1NCAL 3EDEA 2DMCA 2K9UA 3LY6A 5IJVA 3I6GA 1KOAA 4LSDA 3TO2A 3PABA 3TA3A 5ACZA 1NC4D 4PJEA 3ZKMC 1DQLL 3QXTA 3QZWG 4WNQA 4TSBL 1JPTL 2JJUA 1NGQL 3MLYL 5GZOC 4KZDL 1U8QB 2X7LA 3E8UL 3BH9B 4HV8B 4IRSA 4K7FA 3QEQA 5D6CA 4F2MA 3HAEA 5IB5A 3P9MA 5ALBL 2VZVA 3RUGB 3RWGB 5FV2A 5AD0A 3KXFA 4G9DB 1VGEH 1BVKB 2BNRE 1CFTA 1X5AA 1BX2A 2F58H 1FFNB 1DVFD 4YXKL 5T1KD 4XNQA 5ID1A 1RZKH 2AEQH 3EGSA 5EU7E 3PWNB 4R2GB 3PDOB 5C6TL 3RPIA 4POUB 3MNWB 4MNGA 3BRDA 1VGKB 3UCRA 5TFSH 3IDNB 4OLVL 3MA7A 2K1MA 3RVWD 3JV4B 2NY0C 1CGYA 4OF7A 5DFVD 3G5ZB 3C5ZA 1LO4L 4U1SA 1Y6MR 3I50L 4P4KD 1EAPB 2EXWD 2O5YL 1HINH 3G5YA 4ZUVB 5IFJA 3DV4A 4BSWB 2CRIA 4MA7L 3EO9H 4QRSB 3H9HB 5C0JA 1MRFH 5CJ8A 4JREB 4U1GC 5CKAA 3MV7E 1KB5A 4OSUH 2B4CH 4U1JB 1SQ2N 4UILL 3SDDC 1BWWA 3LRGA 4U6YA 4ZTOH 3OKOB 4EOWH 4OV5A 5FDWB 2W60B 1CI5A 1TVDA 3ZYJA 4EBQL 5IIEB 5DURB 3PHOA 3PL6D 4OLXH 3TJEL 2H2PC 4DGVH 1TQBC 3ULVL 3ARDD 3X3GL 3O8XB 4U1NB 1QRNE 3PXHA 3VFUA 2OXGA 3J8F7 4OD2B 2IAMA 4RAVB 1ZGLA 1UKTA 1OF2A 2X4RB 1E4KA 5CP7B 4Y88A 3LIZL 2I9TA 1Q0YH 4OCWL 1EH9A 4PD4K 5L7XH 3L3OB 5BRZB 1XGTA 5I1GL 3ARFB 3HI1A 1V8HA 5I1HH 2QADC 3S3JA 4Y16A 4CADA 2QHRH 3EFDH 1XMWA 3QQNA 4KY1L 5D1ZD 5CSBA 3FO9A 4NO3B 4GLRH 1HOCA 2HRPL 5JA8B 4RBPH 2OQJB 2Z8RA 2VZOA 5D7LA 4ZQKA 4UV7L 1KEMH 4ZUWA 4KK9D 2VB5A 5C0BA 1NMBL 3ZYIA 2O5ZL 3HC0B 5ICYA 1BIIA 4LCUA 4U2YA 5C8JB 2P7TB 1YEEL 4JRXD 4MS8D 3G6DH 1IC7L 3MRBA 5F9OL 2YSSB 4KKBD 5B8CA 5J06A 1GZQA 3DX7A 4QHLA 4N5ED 4K8RL 4KQ4L 5HYQB 2I07B 4UBDD 1MVUA 3W39A 4F7EA 3PP4L 4NQCD 3O3EA 2A6DB 4NGHH 5IB3A 3GMOB 5C07B 3MLRL 4JCLA 4YWGL 5BZWB 3TWCL 4NQTA 3K7UA 2EDEA 3IDJB 1CDUA 1PY4A 3IAQA 4XB7A 2IGFH 4XWOD 3C5JB 4QRRB 5J1SC 3F65A 1FNGA 4PGBB 1U3JA 5KVEL 4B7IA 1YMMD 5DRNB 2D9QB 3AU1A 1NBZB 5E6IC 3G6AB 3L5JA 1VFBB 3L7EA 4Q0XL 1T2JA 2CLRB 2NY7L 4PGJA 1SYVB 4XX1E 4PB0L 1J87A 3TBWA 2NY3C 1X44A 3IJHB 4YDKH 2WP3O 4JZJC 4XI5C 5GS1B 3BZEB 1A4KA 1KIRB 2XN9E 4JFPA 4H1LB 3Q6GH 5E4EB 3TZVD 2A1WL 4WU5A 1PEZA 4QHMA 2X05A 3QUZB 2VWEC 4I5BB 4WV1A 4KK8D 2F5BL 1TVHB 1FPTH 2PO6B 1MJ8H 1ORSA 4MDJA 1I9IH 1NCUA 1Q0XH 4J8RB 3O2WH 1OVZA 1RK1B 3FO1B 4KHXL 5SWQB 3BQUA 5DVMA 2MPAL 2YEZA 1H5BA 1IGML 4ZFGL 4NZRL 1Q9WA 4G6JL 1IM9A 1HWGB 1I7RB 3I75A 2LAGB 5BOZG 1QFWI 3SY0A 5DHVA 4M7JH 2X4TB 3CZJA 4E41B 4KK5C 4YNYA 4ZSOE 3O6LH 5HYJB 2IBGA 1RZJH 1R3HA 1HSAB 1WAAF 4QCIA 2WM0A 3MOAL 1A14L 5BXFA 3L5IA 4NUGH 5E8OA 4X4XB 1U92B 4K07A 2X89D 5FK9A 1YNKH 1F2QA 1NBYB 1QFOA 4MD5A 1CVRA 4YBLB 1FN4A 4F37K 2F53E 5EU5B 3L5WB 3BEWA 2OZ4H 3UTOA 3V4UH 1NL0L 1T22B 3QIWA 5E94A 3QDGA 5D5MF 1G84A 2SEBB 1KG0B 4HZAA 1QFWL 4Y5VC 2VLLA 4JPVL 3ULUE 2C3WA 4D8PB 1VFAB 2GJZA 1XIWD 2QKIB 1U3HB 5FGSA 3UTPD 2XTJE 3V8OA 3E0GA 3W9EA 3IDYB 2UZXB 3DHJA 4QO1A 5HHXH 3GJFA 1BEYL 3LAFA 3MV9D 5DHXB 1CTOA 3TT3H 3VWJC 1XEDA 3DURB 2G5BA 1Z9LA 5H8DA 1OGAE 4PGZA 3S3SA 4BSVA 3OKDA 3QDJE 2HT3D 4ONGH 5JXAH 3D2UA 3O9WD 3PWPB 1QUNA 1BJ1H 2Z91B 3OJVC 2VDRL 1A6AA 2WV3A 5I8CA 4LCWB 1JGDB 5IOPA 4EI5A 2WINB 4LQ1A 1WIUA 5TDPB 3CX5J 4JFDE 4D9QD 2CK0H 5IQ7L 3U4EA 3CX2A 2WAHA 3T0AA 1R24A 1PY9A 4PRIE 3K4AA 4MQXC 3LDBC 2AABH 3OAUL 1WK0A 4NRXB 3D9AH 5HHMD 2WLYA 2P48B 4X6DE 3G5VB 3AREA 1D5ZB 1BFTA 3R0NA 4W4OA 4JO2H 3MRIA 1A7QH 2YC1B 4Y4FC 3E6FA 1OOAA 3TBSB 1VEOA 5FYKL 3O6ML 4X6CB 2PXYB 1KPRA 1CR9L 2M8XA 3GBNH 1Z3GL 3BKJH 4PJIE 5BV7L 3HB3C 5DD0H 3U0PA 2IAND 4R8WL 5CZXC 1Z5LB 2AVGA 4S1SL 5JW5B 1F42A 4RZCB 3NFNA 5F1NB 3UDWC 1P4LB 4I3RL 3K81A 2AKRA 5DD3L 1FL6A 2JIXB 5C0GB 3FO2A 3QDHA 3HMXA 3KR3H 3N1MC 3RZWA 3UPAA 3ZLQC 4JR9L 4KXZI 4Z0BL 2VDKH 4IEFB 3GI8H 1NCWH 1N7ML 2C7UB 3SDXF 3OXSA 5FYLD 5DGQA 4Z7VF 5I1JL 3EO1B 3LHPL 3L9RA 4M3JA 2VYRE 2AV1B 5L88H 5JW4R 4Y19A 1MFAH 3NGBC 1QSFA 4Z7WB 3WNLA 4J4PA 2E6PA 4XCCL 3C8DA 1HYSC 4J3XA 4IMLB 4R26H 1V5JA 5LXGH 3TVMB 3FB6A 4PJAF 4LCIH 2Q6WB 1T1WB 3DV6A 2AXFB 1XGRB 5DJDB 4IRZL 1M05A 5IROC 1MRCL 4J3OC 1CBVH 3NAAL 2X1XR 1WBYA 3H9SD 4PJBA 1CU4H 1WIOA 3VDAA 4GG6F 3L3HB 4KROD 4ZODA 2WIIA 4HJJL 4X4ME 2VLKE 3MXVL 5IMMB 3OAZK 2BY0A 2BNQB 1T3FB 5ETUB 1YYLL 3KJ4C 2UV3A 4FZ8L 4GOSA 4P9HL 1IGFH 2A9NL 3SBWC 4AL8L 1BGXL 1U3HD 3B3IB 3GB7B 5CSZA 1FJ1B 2EKJA 4G42B 3OMZA 2WWMD 3IF1A 1I4FB 5E7BA 2EICA 5E1HB 1WEJL 3MCKB 3VFWA 5DMYA 4NQSA 5L0QB 1J0IA 4YQXH 4HMDA 4FZEL 1RZ7L 4W6WB 4YEFA 1T7VA 5INCA 1DVFC 5EZIL 3SDAD 3SKJL 1BD2E 3SJVA 2HFGH 3KG5A 3QCTL 4WU7B 3MV8E 1T0MA 2ERJC 4XNXH 3LKQA 5I76A 3PWPD 4BJLA 4N8CH 1JN6A 3W2DL 3RVWC 5IMOB 1E6OL 5DJXB 2DQTH 5DFVC 4WI4A 3RJDA 5D2LE 1SY6L 5LG1A 4LCWD 4AEHL 1VACB 5H94B 2W65A 2VLJB 4UTAL 4NC0B 3O4OC 1QLEH 3RWDA 2CD0A 2H6PA 1I1RA 3P4LA 1J8HB 1ITBB 1C5DB 5DEFA 3QG7H 5F6HJ 5HVGB 3TBTB 1GAFL 2VC2L 4XP5L 3D85B 5DK0B 3MLSL 3PL6C 4NZUL 4CW1B 3ARDC 4X7SH 2BMKA 1KCSL 1XZ0A 3CVHB 2WUBL 5I75B 1NLDL 2MQCA 4BUGA 3EOBB 4YO0B 3GHBH 1LHZA 1GOGA 2K3TA 3ROLA 3SE9L 3CMOH 1TITA 4FMKA 5F1IB 4M7LT 5ITBL 4ZO7A 4LBEB 4MSWA 3IJYB 2BDNL 1B2WH 2OM5A 2XFXA 5A2JH 1R3IH 2YK1L 2JIXD 5SWSB 1BAFH 3LH2H 5DDHA 4PRAB 5ERWB 4LIQL 3T3ME 4HKXB 4MQSB 4PJ9A 5TF0A 5GZND 3CX5K 1F00I 1P6FA 1T0NB 1KJMB 4P5KA 4PJHF 1MJ7L 2ED7A 3FT4A 5F9DC 4YHPB 1X5JA 1EHXA 3ARGC 2DQIH 1P4IL 2N56A 3NIGE 4MJIA 4F58H 5DMGD 5MEQB 2FD6H 3D3VE 5EUOE 4P9MH 5F96L 4TSAL 5IK3B 1ZKAA 4KJWC 4DKFH 4KK9C 1I7UB 5BJTA 1QNZL 3L3KB 3PWJA 3MRJB 5I1LB 3LD8C 2QQNL 5JORB 4UNTA 4EKXA 3EYVB 4MS8C 3HUJE 4OQTA 1EK3A 1IRAY 1QFWM 1BJ1J 3E6HA 4MVBD 3L7FB 3QIBA 5CJ5A 4N5EC 1FLTX 3SCMB 1FORL 2ZUSA 4UBDC 5DTFA 1NGWA 4RBPK 2YBRA 1SEQL 5EBMA 2EC9U 5HHPA 5D7IE 1G7JA 4WW1B 4PV9A 4IRSD 1WVZA 2HAZA 3QEQD 5JW4Q 2P5WB 1U8KB 3MRPA 4U6XA 4PRDB 5EFIB 1K2DB 4WI5A 5I8KL 3KXFD 4H26A 4XWOC 3F7VA 2VITB 5DYOB 5F8QC 4HPYL 1H3VA 1XF2B 1VDGA 3IAGC 5LGJA 4UMGA 4BQ6A 1D3CA 4HF5L 4QRPB 2AJ3B 3CZFB 3OZ9L 3RI5F 5EO9B 2HJFA 3BH8B 3AM8A 2HWZL 4MWFA 4R2GC 4WJ5B 5IHUL 3BE1H 5TE4L 1MH5A 4W4NA 2XPGB 2IG2L 2ZCKH 4OZGA 3WHXB 1ZHNA 1FIGH 1MCDA 1AY1H 1JI2A 1AXSA 3KVQA 3VE0A 1XCQA 4MLSA 4X80L 1A3RL 4NHCH 3C5ZD 4NQDA 1N0XH 4YGAB 5LVEA 3SOBL 4GW1A 4HIEA 4HW6A 1YPZE 1PZUB 2B1HH 2B20A 2V7NA 2A9ML 4Y89A 1TZHB 4LRNL 1JGUH 2OCFD 3EOYG 1DQDL 4MD0A 1PSKH 4JREC 4KK8C 4PR5A 1UWXK 1KCRH 3RNKB 4H1LG 5JXEC 3GSOA 1GHFH 2DJSA 2E9JA 4NKOA 1MCWW 1OL0A 3RY4A 3CLEH 4EN3B 3BKCL 2FWOA 5HGDB 2E7MA 1HKLH 1BQHA 4GW4A 3O8XC 1K3IA 4UT6L 3FN0H 1RUKH 2JB5L 3HCVA 1KJ2L 2IAMD 3HTLX 5BO1H 2BRRL 3FCTB 2XQBH 3GNML 3QWOB 4R4BA 4YHMH 1UGNA 1FL5A 4X9FA 5C08A 3RUGF 2GCYB 5DUPL 4NRYB 5DRZA 5SWSD 3FAXA 1T0PB 4Y16D 3MLWL 2FATH 4L3CA 1CE1L 3NCEB 5B22A 5HHNA 1ZT1A 2X4QB 2QR0A 4HQQH 5ID0B 3A6CH 2CO6B 3HI6H 1R0AH 5JOEA 4YGVB 3IJSA 1U9KA 3MUJA 1LO0L 1S7WA 3C60B 3IT8D 3MODH 1JV5B 1QLFB 1YJDL 5D7LD 4P2RB 3VG9C 1CXHA 3ET9F 2FEEI 4GRLB 2I5YH 4NJ9H 5JIHA 2DQDH 4HKJB 1WT5C 2P5EA 1F45A 4UNVA 2R2BA 2VABB 4GAJH 1P7KA 4QTHB 4AIOA 5EU6A 5JQ6H 4P3DB 3HRZB 1BVLA 4YFDB 4WFEE 2MJWA 4PJXA 4HDIB 3LN4B 4DEPC 1SMOA 4KFZC 4XPHL 1H15A 2HT3C 2YXFA 3RU8L 5FM4A 3SPVB 1U58A 3D5OF 5I19H 5FHBH 1J86A 5FCUH 3QDME 4F80A 2AK4A 2P5WD 3L3IB 4WEUD 2FEEL 5FYJE 3LPGA 3FFCA 2F58L 3OKNB 1Z6JT 4IJ3B 5ANMB 5ELIA 4NM8H 1BZ9A 3AS2A 1RZKL 1CF8H 2AEQL 5INDB 3TN0A 1EFQA 4E9LA 4PRBB 3REWA 3VFRA 3C87A 1XAUA 3C2SA 4QRPD 5TFSL 3ZL4L 4G6AD 4JKWA 3QXAB 4LLYB 1BJMA 1CFNA 2UWEB 2XOTA 2EYRA 1JE6A 4NKDA 4I0PA 1AD0B 2IWGA 1DFBL 4BSJA 5J6HB 4FFYH 2HJLB 1AHWA 2Z0BA 3RWFA 3MRRA 4HS3B 2X2YA 1U8MA 3IFPB 4U1LB 1J8KA 4FOMA 2IPUK 5E4EC 5AUMB 2BHZA 2P43B 2GQHA 4W81A 5H2BB 3UTSE 4OSUL 2XXMB 3T2PA 5FYJU 3WYRA 2D3VA 1XCTB 4ZTOL 1AKJB 3FN9A 2R0WL 4CRPA 2HLAA 2ZUQC 3L95A 1PZ5A 3LRHA 4OLXL 4OB5H 5J8OA 1TZGH 1G1YA 1JTTA 4D0DB 1WC7B 5ILTH 1N6QH 4HIXH 4GKNB 3WDJA 1HCFX 1S9VA 5L2KA 5IKCB 3GMMB 3AS3A 4G8IA 1LGVA 5DQ9A 3VMOA 5J1AB 1ADQH 4LNVA 2QQKH 5L7XL 4DZ8A 2BVQB 4R90H 4FQXA 3CFDA 1M7IB 4CN1A 5I1HL 2QHRL 1R5IA 3EFDL 3MACH 5HGBB 1BJ8A 1RJCA 4QRTB 3MV11 4L4VA 5JDSB 4MHHI 4HH8A 4XAWH 4QHNB 3U46B 4HAGA 4YX2H 3EYFA 1RIHH 1QR4A 2NXZB 4YBLC 5HVHB 4WGVB 1MLCB 1X5XA 5J0BA 5FA3B 4KWUA 3QIWD 2XZQH 3QDGD 1KEML 4QYOA 1ITCA 5KVMC 2FX8L 4M9PA 43CAA 2FECI 1M6OA 3RWIB 4UOW0 1QBLH 3TNNB 4QHUB 3PUCA 5DMIH 3UJTH 4N0UA 5T5NG 2BCKA 3G6DL 1JNNH 1U3HC 3CK0H 4PJGA 3EZJB 3S4SB 3PHQA 2WWMC 3BP5A 3GIVA 3IDYC 4L8CB 4K7PY 3RKPA 1NMCC 1QKZH 1QEWA 3VWKA 4G80B 1JZ7A 4OZFA 1TNMA 2OI9B 2Z4QB 4UQ2B 3K46A 4NGHL 1FNHA 5FCSH 4QWWC 3HAEG 3NFPA 4PY8I 4BA8A 3O11B 3DO7B 3GKZA 2FECL 3VXMB 4P23B 4WEMB 3EJJX 1IAOB 3V9FA 2I26N 3GMRB 1ZA6B 2GK0B 5JW3L 5I0DA 4WHTB 1MF2H 4EI5D 4KJYB 5KVDH 1WISA 4LSUH 5BVPL 1FO0H 2EH8H 2DBLH 2FL5B 4B53A 4GKZB 1JZ2A 1CD1B 3HE6B 4LEOB 3KYMA 1X5ZA 1NPUA 4RIRA 4YDKL 4P46B 3RY6A 2A74A 4ODWB 2UZYB 3VMNA 2R2HA 1YN7A 4U6HB 1RZ8B 3QFJE 5F6HI 1JUFB 3Q6GL 3ARED 3ESVF 5ISZA 1PYWB 4PJ5B 3GJEB 4RA3A 1BM3L 4XTRC 2X4SB 1XF3B 4U0RB 3ZYOA 2X4NB 1FPTL 2J8UF 1MJ8L 4JFYB 3KYKH 1Q0XL 1I3VA 1V3LA 3O2WL 4HIJB 4L3AA 1KPUA 1HILB 1YA5A 5IVZA 4I4WA 5DJYB 4F9PA 5CJXA 1IGYB 2XA8H 5E8EA 1I8IA 4HIHB 2IQAA 3VCLB 2VXUH 2ZUUA 1U8LB 4OZIB 3IDMB 2YXMA 3EYQD 4M7JL 5FDYA 3O6FA 3O6LL 5DWUH 3UP1A 5FOBA 4ODUB 2V2WB 4U6VH 5DMGC 3FQTA 4J4PD 3MRGB 1DN0A 4NUGL 4ALAH 4G6FD 1J11A 2WBJA 4NQXB 4OGXH 1YNKL 1KPVA 4JN2B 1DE4A 3E2HC 3V5KA 2ZCLL 2OZ4L 3V4UL 4IOIA 4PTTA 4X9IA 4GRWB 2J12B 2VAAB 5T1LA 1BBJB 3PV6B 4MVBC 1DEDA 4PUBL 5IW1B 4YFLF 3BEVB 3TBYB 3O3AA 2ID5A 3CSPA 3HG1A 4MA3B 4WRLA 4TRPH 1X7QA 3GM0A 3VXSB 5TDNA 1CVSC 1ZLUH 1K4CB 5HHXL 4V2BA 5AG9A 2XV6B 4HGMA 4NN6B 3UC0H 3V4VH 2RQ8A 4X6CF 3TT3L 2V6HA 5CBEA 3ZE1F 4HULB 3WL9A 3W5NA 5L0QC 1MI5E 2YMXH 3SE4A 4ONGL 2B39A 4MAYB 4P0DA 4MNQE 2DQFA 1OWWA 4OZ4B 3SJVD 3VI4E 3MJGX 4ZFZA 4YR6A 2D03L 2ITCA 4C56A 4BFIA 2PTUA 3LQAL 1F5WA 3HC4H 5IHBA 5E1AA 4XVUD 3GMPA 2BHYA 3W11C 1T6VN 2CK0L 3C5ZC 4LL9A 5FO9A 3VGGA 4RQQA 5MERB 3UBXA 1OAUL 5CJQH 4Z7WF 2F8VA 2UVFA 2V5RA 2PUQT 4XPGL 3CXDH 2AABL 4PLOB 2Y06H 2QLVB 1IEHA 3D9AL 3RP1A 4G9FE 2F74B 2GSIA 1FYTB 2BVPB 1S9XB 4PP1D 5C0DA 3K8MA 5KSUB 4KGLA 4OCXH 3D25A 4GS7B 2HN7A 2VXVL 3LS4H 3KPNA 5T5NF 1CICA 3PQYA 4K9EC 4WTXA 2F19H 2Q1EA 1FRGL 5T3ZE 3GBNL 2XWBB 4J23A 3HE7A 2GJ6E 3T8XB 5DD0L 4FQLL 1IGJB 5BW7C 4XH2B 4XNYH 4WI6A 2IAMC 3VGDA 3KR3L 3TYGL 2VDKL 2W9DL 3GI8L 5B3JF 1NCWL 1QFUH 4RFEA 2E27H 4HWBL 3DYOA 1S7XA 4MLIA 3MRDB 4Y0GA 1FFOA 5ADPH 5L88L 5LJYH 2DWEB 2AJYL 1MFAL 4U1HA 5DD5H 1QQDA 4JDVA 4Y1AE 4M00A 2P4AB 3RL1A 4HXAH 1H3XA 4R26L 1WTGT 5LXGL 5I71C 1TCRB 4KAQL 4RISH 4MJID 3VFGH 3VJ6A 4LCIL 4DZBB 3CDCA 1DP0A 4FQ2H 3A6BH 4LHUB 1SJEA 4DCQB 3MRCB 1FNEB 3QCVH 3MUZ1 3T0EA 1JFQH 2E9BA 1CBVL 4B7LA 1FQ9C 4XP1L 1CU4L 2NW3A 4LAJH 1JPFB 3BSZH 3WHE0 2PR4H 2WMPA 3QNZA 35C8H 3BDYL 4P3WA 1IM3A 1ES0B 4JFOA 3KYNB 1A2YA 4Y2DB 4NBXB 1IGFL 1EA9C 4QT5A 3QIBD 1EGJH 1Q38A 1MIML 1YEGH 3EJYD 3IXAA 4Y2OA 4MD4A 4NHUB 1EEZA 1KEGH 2ADGB 4LKCA 4V1DB 4P2OA 3OF6A 3FQNB 3WS6C 2DM7A 3GHEH 3CSYB 1QYGL 1BVZA 5C0IB 4WW2A 1RJLA 1QVOB 4YQXL 4CVZB 2H3NA 2IH3A 5C0ND 2LVEA 4XVJH 2IJ0C 1SY6A 1LE9A 3QAZB 4F7CA 2KKQA 2C4FU 25C8H 3M1BA 4MAYD 1JBJA 1X5IA 1K8IA 4XNXL 4QRUA 3EYOB 3HZYA 4YHNA 3KPSA 4G6AC 3JV6B 3MO1A 4JHAL 4N8CL 2H1PH 2HT2D 2BVOA 2FJFA 2AV7B 2VN7A 2IMNA 3DVIA 1N6VA 1UM5L 4H1LH 4G6MH 2VXQH 3MSPA 4NDMA 4JPKH 4TN9A 1EV2E 5KN5A 4NQDD 2OP4H 4RX4A 1GZPA 1XGYH 5AWNH 1KLGA 2APFA 1QLEL 2G2RA 3N9GH 43C9B 5J13C 1HIMH 2FO4A 5F7YC 3C8KB 3SKMA 4L5FH 2XI9A 2CLZB 4FHBD 4LSTH 1ORQB 3QG7L 4XXDA 3UO1H 1ED3B 3IU3B 2EDLA 3RX5A 3H3BC 3T3PF 1FYTD 1I1AA 1WZMA 3NZ8A 1M7DB 3BWAB 4G8GB 4XMLL 1FAIH 3FB7A 4CVXA 4X7SL 2ITDB 4LCCA 3T77B 3KPRA 3LZFL 4OLZL 4EN3C 1CZ8H 4J3VA 4PG9A 1NCCH 1B88A 3GHBL 4KJPD 1BBDH 3CMOL 3IRPX 3HHRB 1I8KB 3QI9D 4LLMA 4UQ3A 3VRLF 5HHQA 2W9LA 5H35B 1B2WL 1BAFL 2DYPB 1HHIA 3ZMRA 3LH2L 3HR6A 4RFOL 3BVNA 1J18A 3MRMB 5HI4D 5C08D 2NLJA 2VUOA 2ZG3A 1VADA 4MJ5B 2DMBA 1FDLH 2WANA 3PNWB 2EZ0D 2Z31A 3OWEA 2DQIL 4F58L 2FD6L 3MRKB 4J3WA 4P9ML 4CN4A 3QIWC 4PRPA 3ZZ1A 4OTXH 5IESH 1CXEA 2KZ1B 3C60C 2Z9TA 4XCFH 2FJHB 4H25B 4NC1E 3WKML 5E2VH 3EHBC 4R7NA 2X4UA 3WKNA 4HMEA 4TNVF 3K4ZA 4JQVC 2P5ED 3GSNA 4ZAKB 5EU6D 2LTQB 1OB1B 2EYSA 3C6LB 1ZE3C 4LPVA 1XGQB 2AXJA 1QA9B 1ZXQA 2R8SH 3W5MA 5D2NE 4OM1L 2Y36H 1OTTD 1QBBA 3MMEA 3DX9B 4MDIA 2CKBB 4JAMB 3AROA 1N2RA 2VLRA 3TCXA 5FUZH 3MFFA 4XCNA 3I6KA 4NM4H 4HSQA 2AK4D 1G7IA 2MTPA 2O5XH 4AQ1B 5E9DA 1UXSB 1VEPA 3FFCD 5F93C 5M94B 3VXQB 1CXLA 5DJ6A 5I1EH 5LKNA 3BE1L 3OKKA 3TN0D 3FKUS 5DQJB 2ZCKL 2V5MA 5FGBC 1FIGL 4LHQB 4UDTA 2X9YA 5JPNB 4NHCL 1N0XL 5D6DA 4I0PD 1NDGB 3BW9B 5HPMB 1HH6A 2B1HL 4Y4KB 1MY7A 2GYSA 3AREC 4U7KA 1G6RL 4LQFH 3CFBB 1U8NA 3VD5A 1JGUL 1AGEB 4AMKH 3DNKA 5GRVK 3ULVD 4NIKB 4D3CH 1NGXB 3U83A 4X7EC 4ETQA 3MLXL 1KCRL 1KJ2A 1GHFL 5JO5A 4OKVB 1NFDB 5KTEH 4TUKH 3CLEL 1AQDA 2HFFA 4LOUD 3NIFE 4ZSOA 5GHWH 4L3EA 4GXUN 4R3SA 1HKLL 1TPXB 4TTDC 2B8OT 1T5XA 2OSLA 1N0LA 2YPLE 1XF4A 1RUKL 3EYQC 3STBA 5L2KD 3DETC 2X4PB 3AFLA 2XQBL 3TBVB 1RZGB 6CGTA 3FMGH 4M8QB 1F4XH 2LVCA 1A02N 1IGTA 2BC4B 5C3TA 2EC9T 4L4TE 5CHNA 3JTSA 1W0YT 2EECA 3RI5K 4MXVE 2FATL 5GRJH 2RFXB 5C0CA 4L4VD 3E3QC 1WBZA 4L8DA 1RPQA 3A6CL 4MNHB 4QOKA 3OKLA 3HI6L 2ZWLT 1R0AL 1MIEH 3I02A 2V2TA 2NXZC 3RL2A 1SYSA 5HVHC 2BY1A 2DOCA 3MODL 2RGSA 1UXWA 2PW1B 4IOFD 3LKSA 2FJGB 2UWEF 3MJ8A 3KPLA 4JFHD 2Y72A 2I5YL 5C09E 4M61A 4NJ9L 3HAEH 5I1DA 3DROB 3LQZA 4JKLA 4GAJL 3V6BR 4LLQB 4CU6A 5JHDB 1HHJB 5F7LB 2E6QA 1HEZB 2VE6B 2ZZUT 2JCCA 2QJDA 1BECA 3STZB 2GTZB 3G04A 2WBKA 3VXNA 4JY5L 1R3JB 1J05A 3KPQA 3FQWA 3MREA 3GI9L 5I1CH 1CGTA 4MA1B 4PYGA 3C6LD 2OI9C 4IS6A 3WFHA 2YOCA 4IM8A 5I15H 5I19L 5EC2A 5FHBL 4PLNC 4JFDA 4OZHF 1P53A 1QSEA 2YUZA 1A7PL 3C2AL 4OCYH 5BCAA 1BREA 2A6IA 2ENSA 1IZKA 3ZE0F 3QO1B 4NM8L 4XVUC 1YNLH 2GT9A 4K3EH 5CCKH 1CF8L 1ZLUK 5J57B 1LE5B 4FTVA 4JY4A 2VTFA 5ITFB 2Q7YB 5SWZA 1UH3A 1OM3H 3P4NA 5IEKA 3PGDB 1KB5H 1U8OA 3TP4A 3MLUH 1A7OL 3HE6C 4JCMA 5ESVA 4JLRA 2DD8H 3G08B 4K9EH 4AEIH 4P46C 1RULH 3BP4B 1TETH 2Q86A 1EXUB 4LPYA 5DJ2B 3RWJA 4HKZB 4HT1H 3L6FB 3K80A 2GAZA 1AGFA 3V6ZA 5ISZD 2I27N 2CIKA 1UACH 1GGBH 5KSBE 5EBGA 1T2QH 1WIPA 5T1MA 4BM7A 3ILPB 4O2EB 4S2SA 5EN2A 2NY2D 5CJOH 3CFJA 3VXRA 2AGJH 4OB5L 1QBAA 5F1SA 1TZGL 3H6JA 1XT5A 1BQHG 3RWEB 5HYJE 5ILTL 1N6QL 4HIXL 4ZNEE 3VRIB 5C0RH 5E24E 1C12B 3MQIA 3KHQA 1ACZA 2GFBB 4NT6A 2PCPA 3EJZD 4XCEB 5I17A 4BH8A 2GJJA 1ADQL 3QRFM 2QQKL 4R90L 1JYVA 4WEBH 1TTGA 2UUDH 3QA3A 4BKLA 5J56B 4HS8H 3MACL 4X5WA 4XBGA 4PB9H 2GHWB 5FA4A 2PYFB 2WBJD 3D39E 3P9MB 5DK2A 1SBSL 2I9LB 1RIHL 2DF3A 4OV6F 1U8PA 4GQ9L 4NQUA 4C57C 1S7VB 4I48B 1CFTB 5EB9A 2NX5B 1A6VH 4XNQB 5T1LD 4UI2A 1QBLL 2DQGH 4UDUB 2AI0H 3QIBC 4QTIH 3UJTL 3SE8H 2HVJA 4WO4D 3S5LA 5DEGA 2BNRB 1JNNL 1HHGB 3HFMH 3HG1D 1IBGH 3U9PH 5I6XB 3MA7B 3ULSB 1S3KH 5DMKA 3QRGH 2OXHA 1QKZL 4ZDHB 5FF6A 5EO0A 1BF8A 5DFWH 2RB8A 4NN6C 3MV8A 4WUUE 3G5YB 4YZFE 3DVGB 1D6EB 1TVBB 3OG6B 4LARL 2P1YA 4ELMA 4TPRH 1WBXA 5DRXA 2P46B 3QUXA 3MLTB 2PW2A 4C4KT 1DBAH 4MAYC 2EC8A 1TZIA 1NCBH 3GSVB 3B5TA 4F7TA 4AT6A 5E7FA 1MVFA 4XT1C 2ZNWA 4OZIF 1IE5A 2BSTA 5GRVL 2HT2C 4C56D 3O0RH 1Q9LA 3L1OH 1HXYB 4U3CA 3NOIA 3MV7B 3B9EA 2KH2B 1MF2L 4Q6IA 5KVDL 5CKGA 3QXDA 4LSUL 1RJZB 1FO0L 1PKQA 4M03A 2EH8L 2DBLL 4FXGA 3QYCA 4EVNB 4EQ2A 5IVNA 1JJUA 3HKFA 4HUMB 4M8VA 5FYKD 5E8PB 4ZUUB 3PDDA 2G9HA 3BPNB 1QRNB 5D7KE 1UCTA 5C6WH 5L2JA 3HI1B 5GGTA 1JF1A 5DXWA 4R7DB 4GS7C 1RUMH 2FX7L 4UZGA 3CCHA 1F6AB 1CICD 2FYYA 3PQYD 5E5MA 3KYKL 2R56H 3VXPA 3HE7D 1ZT7B 2PYEA 3PGCA 1S5IH 5IBUG 3QI9C 2IFFL 5C0BB 4HS6A 5ICYB 4Z7OE 2R9HD 3OKYA 1HXMB 1MFNA 4ZPTA 5EUOA 5HI4C 3MRLB 1BLNA 4PJDE 1BQLH 1NGZA 2AQ3A 3MR9B 1Q72H 3BOVA 2X4OB 3MRBB 4XBPA 5DWUL 1I1YA 1CDJA 4WWKB 1I9JH 2OZ4A 1GZQB 4G43A 5B38B 3O45A 3P73B 3FOMB 4U6VL 2IEPA 3RWHA 4XAKD 4CUCA 1CD8A 2NY6B 2X5PA 4OGXL 1P7QA 1KJ3H 5HGHB 4U3HA 3OB0H 5IF0A 4ZOEA 4YUEH 1S5HB 1TJIH 3IFNH 5DS8B 4XPAH 2DI8A 3T0ED 1MJJB 5MHSE 1QR1B 3EOAA 3GJFH 1LEGB 5A16A 4PPTA 3QUKA 4O2CB 4PJFB 3ROOB 1AC6A 3VXUE 5TGBB 1QPXA 1KC5H 3X13B 1A6PA 1U93B 3U4AA 3MUGA 5CEYB 4L9LA 4UNUA 3L7EB 1VHPA 4TRPL 4JHWH 5IVXB 4PRHA 2ICWB 4P2OD 3OF6D 3UC0L 1P84J 3V4VL 5GIRB 2NY5C 3ARBA 4OZFG 5DLMH 1AP2A 4APQD 4GRMB 4WIQA 3BZ4A 4RNRB 3MROB 4DN3H 2C1OA 1GPOH 1AD9A 4ZS6D 3QAZC 4LLVA 3SKOB 1M7XA 1T4KB 3FOLB 2XN9B 1OW0A 2V7HA 1JHKH 2ZJSH 3BISA 3LCYA 4KMTL 3KPSD 1BWMA 3RKDD 3IFOB 1H5BB 3OHXA 4JRYE 4X6EA 5KSAB 4I0PC 4DUVA 4ZOBA 5CJQL 1IM9B 3DSNA 3D0VB 1EVUA 1AHWC 5HVWA 4HUXA 3CXDL 5EOCH 4FQIH 1IAIH 1TJGH 3FT3B 3UYPA 2Y06L 4RMQA 4YEEA 5DRWB 4OCXL 4LVOB 5TH2A 1JWUA 3QQ4B 5EDXA 2EIZA 2MMXA 1I1AD 4LOUC 4YLQT 3VFTA 4M1CD 2F19L 1JZ3A 1HH9A 3HZKB 4HWBA 4KRPB 5HJ3A 4ODSH 4XPBH 3KPRD 3MBEB 2FNBA 3BEWB 4OF8A 1B0GA 4XNUL 2ZOLA 4D2NA 5FECA 3RY5A 3DUUB 4POZD 4PJXF 2IH1A 5TJWK 1CFVL 1I7TB 5EU4B 2F53B 2E27L 3P77A 2ZKHL 2E7LA 4ACPA 3GIZH 3WIFA 4P48A 5ADPL 4YK4B 3BP6A 5DD5L 3KLDA 1JWSA 4DAGH 2MHAA 1A6TB 1UVQA 3C9NA 3SN6N 3W0WE 1NANH 4HXAL 4KDVA 3GSXA 4ZYKB 2Z31D 3VU2A 2XTJB 3X11A 2GI7A 4QXTA 4RISL 4CNIA 5BS0A 3VFGL 5IMLA 2EEBA 1ZHKA 4NO0B 1S9WA 3G6JE 5JHLL 4FQ2L 3A6BL 4NN7B 4PRPD 3U48A 5FB8A 1YNTB 2WW8A 2XKNA 3FFDB 3QCVL 4P2YA 1JFQL 3FB8B 1MELA 2Q76B 5HDBE 3D2UB 4F8QA 3ES6B 3BIKB 3BSZL 2PR4L 3W9DB 1OGAB 2Y25A 3G5XA 5LBSH 2RCSH 35C8L 3KPOB 3QJFA 3F12A 4KRNA 4FFWD 1IGIL 2HLFD 3LS5H 1WFOA 2A6JB 4Y5YB 3I6LE 5E8NA 1EGJL 3O3DB 1YEGL 2DAVA 1A9BB 5D1QB 3U4EB 1KEGL 5EBWA 3QUMB 2X70B 3C6LC 1NEZA 5ESQA 3GHEL 3D1MC 1RJYB 2DIAA 1S7QB 4AH2A 2H2SD 1T1XB 3L3DB 5GGRY 1LO2H 5IHZA 3CFEB 2VLRD 4H8WC 4G8FA 4XVJL 2DLHA 4PRIB 3GGWB 4N0YH 3MGOB 1T1YB 2P8PA 1OP9A 4PJCE 3BRFA 5E9DD 3SDDA 1NGPL 25C8L 1I85C 4X6DB 1S7TA 3VRJB 1OAZH 2H1PL 4OJFH 1KXVC 2XN9D 3RZCB 4DGIH 1S7SB 5MENE 1B0RA 3NFNB 3CH1B 3STLB 4KVNH 3LB6D 2VXQL 2ZOKB 3UYOD 4PJIB 3DLQR 4JFQB 2OP4L 2APXA 8FABB 2ADIA 1VFOA 1XGYL 5AWNL 3N9GL 3BGMB 1D5IH 1HIML 4JANB 1F11A 1AC0A 3KPMA 1G7MB 3PG2A 5GJTH 1F3JA 1SJHA 3IVKB 3FHAA 2E7CA 1QSFB 4LSTL 2BSSB 3UO1L 4DVBA 5KZCB 1S7UA 5LQBH 2ZUVA 1P84K 1OLLA 3BP7B 2BSRB 3MJ7B 2IADB 1R3LB 5ICZA 1FAIL 2BVUA 5CJXC 5TQ0L 2R1XA 3WHE1 4F7MA 5CWSB 4RAUB 1CZ8L 4KH2A 1GGCH 4NN5C 4L3ED 1TPXC 5C0FB 1NCCL 4YDJB 1BBDL 3EJZC 1ZT4B 4F7PB 5DUBB 3BFOA 4XCYA 1EMTH 3CAFA 4LRIC 1BF2A 4GAYA 1AJ7H 1FVCB 1CK0H 2F53D 2HFTA 3O2DH 2VLKB 2DWDA 5CSZB 1JHTB 3EAKA 5KW9H 1FDLL 3CJJA 4Z78A 2QBWA 4D0CB 5C0CD 4UV4H 1MCBA 5J9PB 1LP9E 4GKSA 3QNYB 3ULUD 4YPGB 1I8LA 3TM6A 1AGDA 1RFDH 4OTXL 1XH3A 4QNPF 1T1ZB 3ZDXE 5A43C 5INCB 4S0SD 2C4FT 4K3JH 4NO0D 1WAAA 3KWWB 4L8BB 4XCFL 1ZK9A 4QXUH 1E4JA 2YN5A 3ORJA 4WO4C 1MCWM 2UUDK 4NQEE 4M43H 2ESVE 3U0TA 3NA4A 5DR5H 3DUSA 1OGAD 4YFLI 5ADOH 4P2QE 3SDCD 3QDJD 3IKCA 1BP3B 5E6IA 4JFFB 3L5XH 4OBRA 4ZPVA 5K9OB 3SKUD 4RGNE 4MJ6B 5D5MA 2KQMA 5EH1A 2R8SL 4NOFA 2ZG2A 3MNVB 5EZLA 4Z7NF 5IM7A 2Y36L 5D2LB 5ANME 2H9GA 4PRNB 4MA1C 2H6PB 3I3BA 2CO7B 3DTXA 1RIVH 1H8SA 5FUZL 1MCOH 4NM4L 4JFDD 5EOCJ 1LDSA 3F5WB 2QSCH 1YY8A 4ZS7L 2O5XL 3WXVH 4BYHA 3IDGA 3HZVA 4XPFH 3ZTJG 1SEBB 2OX5A 4M7ZB 3FRPG 1I3RA 3JTTB 5FKAA 1XZ0B 5I1EL 1G6RA 2IALA 1J9CT 1G7LA 3NTCL 3CU7A 3TPKA 5I18H 4RFNB 4H20H 4Z7QE 3BYTA 4A6YB 3NCJH 3QHFH 2XICA 3RZCD 1MCPL 1C08A 3K74B 4PY7A 4WDIB 3V79C 4D94A 3B5HA 2H8PB 3BXNB 4LQFL 4M6OH 2ADFL 4JRWA 5E5RB 4AMKL 1KIQA 2P44B 4D3CL 4P5KB 4AYFA 4TNVK 3QEUB 1CICC 4KTYA 5F7DA 4BZYA 3D6GA 4JG1L 4TVPE 2KQNA 1NFIA 5KTEL 1ZVHA 4OLYH 4TUKL 4EJ1C 2EDOA 4JFXA 1T83C 4YJZL 3T2OA 3VXRD 5GHWL 4AENA 2R1YB 4G8EA 4OM0H 4NPYB 2DTMH 3D3VB 5F7KC 2HMIC 3CNKA 5HHVL 3WCYA 4FG6D 5E00B 4Y5VA 4EDXA 3WNNA 1TENA 4NKMA 5C0AA 2R69H 3QSKB 3WFDH 3FMGL 3DRQB 4FQHA 2ILLA 2XNAB 2AXGB 1NAMB 5DTFB 1HK6A 2YBRB 3E8UH 3T0DA 5EBMB 5GRJL 3ALWA 3WLWD 1MHCB 5CD3A 1F4AA 4NZDA 2JB6A 2VLKD 1L9MA 1Y0LB 4ELKA 1YC7A 5B38G 4X98A 5ALBH 4IMKC 1MIEL 2BFVH 1CQYA 3SDXA 1UWEH 4Z7VA 5D7IB 3F7VB 1LO3H 1KACB 2NTFA 4U1KB 4YXKH 1DQMH 1G0XA 3OPZH 1CFBA 3V5HA 1KYOJ 2NY5H 4RWYL 5IMKB 1UKQA 4GG8B 2NCMA 4P57A 4PJAA 3I2CH 1RZIB 4LGRB 3OXRA 4P5TD 1OT2A 2Z8SA 3Q1SH 4P2OC 3KLAA 2Z8VC 3O4LE 1CE6A 1EBAA 4MXQD 1YDPA 1FZKA 3OB0K 2YZ8A 1BD2D 4PGDA 4U33A 1MHPH 4K3DH 3P3YA 4GG6A 3VXME 1JHLL 1V7ML 5EU7C 3MV8D 4APQC 2QV2A 2CRMA 5I1CL 4DWHA 3GJFK 1K4DB 2CQVA 2IPTH 1KXTB 2IC2A 2CDFA 5CINH 4ZS6C 1X9QA 4OCYL 2DLFH 1FL3A 4PR5B 5CEXB 3QUXD 1WWBX 4LVHB 1YPZB 1A64A 3VXTB 3VD7A 4XX1G 4YAQA 2EE2A 4Y4FA 3RKDC 1YNLL 1QG3A 4K3EL 1VERA 4RCAA 5CCKL 2P8LB 4MCZA 1NDMB 5AZEL 3TJEH 4O51A 1A9EB 2FWOB 2YA1A 3BWUC 1OM3L 3VFSB 3I3DA 2BSED 1KB5L 1JPGA 5IBTL 4GSDH 3MUY1 2CRZA 3MLUL 4KPHH 3UDWA 1WCQA 5E2TH 5CGTA 3LIZH 5B39B 1K6QH 1G7HB 2DDQH 4M7LH 4KMQA 4I2XE 3QEHB 1UB5B 1J5OH 4OCWH 4HFUH 2DD8L 4K9EL 5EBLB 1N59A 1WZKA 3VFPB 2GJ6A 4HAFA 5JDJA 1MFBH 3WV0A 4HT1L 2YUXA 3CVHL 4OLWH 2VR5A 5FV1L 5C9JB 1UACL 4ESKA 4M1CC 5HSFA 3GSRA 4HIIB 1GGBL 1TTFA 2ATKB 3VFVA 1T2QL 1U91A 1HDMA 4OAWB 4POZC 1ADQA 2AGJL 3O3UN 1P7HL 1WCBA 5IROA 3TIDA 2HJKA 3AMLA 4LKXA 2VZ3A 4ORGB 2EE3A 3LEXA 4XNMB 4K7PH 3MYJB 4EDWH 2WIMA 1A1OA 4TULH 4JN1H 3NBNA 1IC7H 2Q7NA 4K23H 5F9OH 3MJ6A 3U36A 4WEBL 1PLGH 5F6IC 2FR4A 4HS8L 5F89A 3N50A 4J1UA 4GBXB 2MQ0A 4CBPA 3NACH 3VFMB 4FQQB 4PB9L 4GRWE 3KLHD 4BQ9A 4PJHE 1P7QD 4NO2A 1U58B 5GGRB 3LKPA 2K7QA 5L8LB 2RAMA 4NCC1 3S88H 5T1KA 4X6BA 2WWKO 1HHHB 4OZFH 3MRQB 1A6VL 1OTUD 2HLFC 4C58B 2DQGL 2WSKA 4LSRL 2AI0L 5KVEH 4QF1A 3QDMB 4QTIL 3SE8L 5B21A 1KIPA 4Q0XH 3HFML 1IBGL 2CKBH 5E95B 3U9PL 5I9QB 3DMMB 4H8WH 1S3KL 1E27A 3QIUB 3INUH 2EYRB 1PQZB 3O3BA 3OR6B 3GDBA 5EIIA 1ULVA 1IEAA 4OFVA 1GGYA 3X14A 4E42B 4ONHA 4U05A 1U8MB 2AEPL 4GT7A 3TH3T 1FO0A 1LEIA 2ARJB 3LQMA 5DD1H 4HGWA 1DBAL 1R3KB 2UZIH 1KTLB 2CDGA 4WFHE 1NCBL 5JMRA 1G0DA 2OTWB 3U6RA 1EEQA 5HDLA 3IDIB 2HG5B 4JZNB 3L1OL 3ARDA 5IB4B 4R97C 3UTTA 3LB6C 3UTSB 5I2IB 3UPRA 3S96A 2MPAH 1I3GH 1KGCE 2DRUA 3LN5B 3OTTA 2DJ4A 3DBXB 1IEBA 1X4ZA 1W2KT 4LFHD 3OKMB 3DVNA 5KSAC 1FZJA 5M7QA 3NCYP 2ORBH 5F7NC 3RGHA 2EDJA 1KYOK 4ZUTA 2XWJB 3B8SA 1DTUA 3BUYB 5GGQH 4FQXB 1HKFA 4KVCL 2VH5L 3MOAH 4DUXA 3QNXA 5FO7A 4X8JA 1WQVT 4LVOC 4HD9A 1H3PH 1TDQA 5DVOA 4F3FA 4JFEB 3QFDB 3BESR 3ARGA 3PE9A 2R56L 5K9JH 5M95B 4KRPC 4JRXE 4P2CG 4PGCB 1M71A 4R96B 1S5IL 2VQ1A 3MBEC 3L3GA 4UUJA 5ENWB 1KJVB 2WBWB 3KLSA 3TNMA 4F33B 4X5LA 2XY2A 1A7BA 3RAJH 3BIBX 4HFWB 2E8ZA 4JPVH 4YHIA 1FV1A 5IJKA 3HPLB 1D5XB 3NN8B 1BQLL 1DDHA 4NQCE 1ERNA 1K85A 1Q72L 2LU4A 3DXAE 4OIAA 5HY9B 5CFHA 3BP5B 1EDQA 3ZT7A 3SHSA 3TPUB 5DJAB 3VWKB 3ULUC 1FE8H 3O41B 1IGCH 3BH9A 2P47B 4HV8A 1UG9A 2XTJC 1KJ3L 3ALXA 3N85H 3NFPB 4HZLB 2YWZA 4WUKL 4YUEL 1TJIL 3IFNL 1YMME 4XPAL 4NN7C 2CLVA 3RUGA 3RWGA 4Y8DC 1JMZA 4G9DA 1BVKA 1EHAA 1V3KA 4WFED 2C3HA 3J7HA 4MHHG 4V1DE 1FFNA 3SDCC 3QEGH 1CS6A 4OUUB 2MSPA 4AEFA 4FQ1H 3PWNA 3PDOA 1DUYB 4BK4A 3C6SB 3QDMD 3MNWA 2VKWA 2WUCH 4JHWL 1MAJA 1VGKA 4OCSH 3W82A 1EZVX 3IDNA 5FYJD 4JKPH 5DJ0B 4WHCA 1JGEB 1HI6A 3G5ZA 5DHYB 5DLML 1EAPA 3ARWA 1YN7B 2XQYG 4ZUVA 2NY4B 4BSWA 4A2LA 4QRSA 4DN3L 3H9HA 3GZKA 2G5RA 1U95B 1N5AB 1AGBB 1GPOL 3ECBB 3O81A 4YDIH 3N1FC 3SDDD 4U1JA 5JXEA 3QFJB 1JHKL 2ZJSL 3VGEA 2EDBA 2OR9H 2E7BA 5GSVB 3OKOA 1OAYL 3UYRH 2W60A 5IIEA 5KS9B 4X5XB 4LSQH 3RZCC 4XB8A 1BZQK 4UAOC 5AZ2H 4CAGA 3O8XA 2HA1A 4Z0BH 3ULUF 1XF5B 4U1NA 5E6YA 3OJMB 4OD2A 3MGAA 4RAVA 5EOCL 3O6FB 4FQIL 1IAIL 1TJGL 2DKUA 2X4RA 1IC1A 2JJSC 3MOQA 3EYSH 5FOBB 4AIXA 1XGPB 3L3OA 5BRZA 3LN9A 1UH2A 4XCCH 1H3TA 3N06B 3ARFA 1NAKL 3U2SB 1P6AB 4NO3A 4ODSL 1BZ7B 3IRZA 2H32H 3DYMA 3UTPE 3ILQC 2OQJA 4IOIB 4KXZH 2Y4SA 4U7MA 4Q6YA 2J5LB 4M6MH 4NFBA 3MXVH 2C1PB 4LGPB 2Q8BH 3H8NA 3R8QA 4D0BB 5EC1B 3MV9E 3HC0A 4FZ8H 1G9MC 5C8JA 3GMLA 2IMMA 5HTSA 3CDGB 3S37H 2NY1B 2P7TA 3GIZL 4UIMA 4WFFD 1MWAB 3UTQB 2YSSA 4DAGL 4MB5A 5EG6C 1JWMB 4NUJB 1B4JH 3P4OB 1TJHH 5HYQA 2I07A 3QT2A 5CBEB 2AP2A 3K2MC 4X6DF 2CMRH 1MPAL 1OD7A 2A6DA 2I24N 3GMOA 5C07A 1EGJA 4D9QE 4WVRA 5BZWA 2FH6A 1JNJA 5DA0B 3QDAA 2ITCB 4HCRA 5L8JB 3IDJA 4P5TC 5LBSL 1EHLH 2RCSL 1MI5B 3C5JA 4QRRA 3H7BB 2OJEB 1KTRL 3LS5L 4MNQB 4MXQC 4X0KB 4YE4H 1NSNH 4W6YB 5EORH 5HHME 1SY6H 4PGBA 4KTDH 3Q3GB 3ZSTA 5DRNA 3UBXB 4K94C 3ZTJH 5E6ID 3G6AA 1VFBA 5GSRB 3JWDC 4UTAH 5JUEL 2NY3D 3IJHA 4Z5RB 1LO2L 2AQ2A 4FP8H 2IANE 1JNLH 3BZEA 1KIRA 1T5WB 1KENH 2HN7B 3NIDE 4H1LA 3GSQB 1MREH 5D9SB 3KPNB 4CMMB 5C92A 5HYEA 4Z7UE 1P4BH 3QUZA 4G9FB 2YKLH 1OHQA 4I5BA 1TVHA 3WUZA 2PO6A 4OJFL 4PLJC 1W0VB 1TIUA 2I25N 5FYLE 4DGIL 4J8RA 1RK1A 3QFJD 2XT1B 3FO1A 4KVNL 5SWQA 1IL1B 4RFNC 4PJ7B 4XGZB 4Y8AA 1UJTA 3DIFB 4JZOB 4N9GB 5J11C 1T20B 2BDNH 4HMCA 1I7RA 4UT7H 4LIQH 1D5IL 4KJQD 4NBZB 1NFDE 1DBKH 1DQJB 5B39G 3DI3B 2X4TA 3WE6B 4E41A 5JOPE 4ODBD 1T7YA 3I3EA 4XC3H 3V0WH 1INDL 5HYJA 1MJ7H 3MRNA 5IG7B 3RL1B 32C2B 1HSAA 2XACC 2VDOH 5FFLA 4RSVA 5LQBL 1E4XI 3RX8A 3OR7B 5F96H 5LCVH 1F02I 4X4XA 3WEXB 1U92A 4PV8B 4XP6H 4Y1AB 1GXEA 3ZE2F 4OLUH 1Q94B 1NBYA 3DGCR 1GGCL 2EEAA 5EU5A 3L5WA 4JM2B 2QQNH 1T22A 3FN3A 4KUCF 1A1MB 4RMUA 1KG0A 4ELMF 1EMTL 5C0AD 1UB6A 5D2LF 3NPSC 3EOTL 2OK0H 1VFAA 1CK0L 2DKMA 1PKOA 2QKIA 1U3HA 5A40E 3O2DL 5IHLB 3KLHC 1E4XL 1A6WH 5KW9L 3UZVB 4EI6B 4LVNC 3OJDB 3RDTB 1UWGH 1XFPA 1BIHA 1J1OH 1G7PB 4NJAL 3GSNH 4DGYH 4XXCC 1S78D 4H0IA 4BH7B 3DURA 3QQ3A 5I8KH 1DBJH 2HTKD 4K3JL 4HPYH 1YN6B 5JHDE 5KANG 2NXYD 1B6UA 4M7KL 4QXUL 4R9HA 3X17A 3BGFB 5F7FA 3PWPA 4M43L 2Z91A 4Z0XB 5MEPB 1MUJB 4PD4J 2HWZH 4L9LC 4Y4HB 1FYHB 1QSZA 4LCWA 5ADOL 3FO0H 1JGDA 5TDOB 2WINA 3DGGB 3FT2A 5T33H 5TDPA 1A3RH 3SO3B 4OCLC 4Z9KB 3HS0B 1PBYA 4IRJB 3LQAC 4GKOA 3T3MF 5C70A 1KLGB 5J3HD 4LRNH 4IDJH 4F57H 1RIVL 3BDXA 3SKMB 4H5SA 1MCOL 1FVEB 3D0LB 4KDTC 3OX8B 3RGVB 2MCPH 3G5VA 3SGEI 1D5ZA 3NIGF 3WXVL 5EUOF 1ZHLB 4XPFL 1Z2KA 1Z9SA 2YC1A 4Y4FD 5LGHH 4CKVX 3WO4B 4YHLH 3FB7B 4UT9H 2X42A 3TBSA 4LCCB 2C5DC 4X6CA 3LV3A 3H0TB 1DL7H 3HB3D 5I18L 4H20L 2FBJH 1A8JH 1CDIA 1Z5LA 3CDYA 4YC2C 5JW5A 5JA9A 3HUJF 3NCJL 3QHFL 4RZCA 5F1NA 1P4LA 4QXGH 2D0GA 4U7SA 4O5LH 2JIXA 5C0GA 4YDLB 4FN0A 3CIQA 5T3ZD 4Y7MA 1NEUA 1OLZA 2C7UA 2GJ6D 4LK4A 4M6OL 3VD3A 4HH9B 5D7IF 1IAIM 1Q9OB 3CFKB 4HHAB 4ONOA 1CE1H 2AV1A 1RAMA 2AJZA 1UZ6E 4Z7WA 5E03A 1BFOB 2DLGA 3MTRA 3QH3B 4OLYL 1DLHB 2OL3B 4GXUM 2Q6WA 2YD1A 1T1WA 4OM0L 1S9YB 4PJEE 2AXFA 2DTML 4ZFOL 5ESAB 4Y1AD 4DQOL 4BELD 1JNHB 2F54B 4QRQB 3ULUH 1MHHB 1F90L 3L3HA 4A2MA 2E7LC 2R69L 3TV3H 1JCKA 3QEQE 5IMMA 1J7VR 1MQ8A 3WFDL 3AB0C 2BNQA 1T3FA 5ETUA 2X1QA 5KG9A 3P4MB 1YPZF 4GBXC 4NSKB 1KTKE 4XPHH 5C7XH 3RU8H 1FJ1A 4TUJB 2NX5E 3AY4C 4G42A 1X5GA 1NCDH 2BJMH 3VMPA 2BFVL 3MFFB 4I3GA 1UWEL 1J0YA 3KPPB 3V2AR 3MCKA 4F15B 2DQJH 4MNGE 1LO3L 4OD1H 5TPWH 3B5GA 2Z92B 5D2NB 1KFAH 3LKOB 5FGCB 4DTGH 1DQML 1DEEB 3OPZL 3WSQL 1QHPA 4CL7A 2NY5L 2ZSWB 4WU7A 4AIZB 1WITA 3I2CL 3PF2A 5FHAL 3ZL4H 3Q1SL 2IPKB 5BZDA 2RHEA 4N8VB 3DMMC 5IMOA 6FABL 4MYWB 3RTQB 5I1KL 1MHPL 2YPKB 4K3DL 2E9WA 1DFBH 1VACA 5H94A 2D0FA 2D0HA 4WFGE 2VLJA 4KU1A 1RSFA 1FG9C 2IPTL 2AJUL 5CINL 4NYLB 1IVLA 2DLFL 4PJ8B 1G7QB 3EUUA 1CGWA 4U1IB 4P5MB 1J8HA 1C5DA 1KJ2B 4WI3A 4NO5B 5GGSY 3TBTA 2R0WH 5BMFH 2H26B 5T3XE 1FP5A 3D85A 5DK0A 2J88H 2HFFB 1N6UA 4M02A 4BQCA 1KULA 4CW1A 3UTTD 1U8JB 1T5XB 3ZT5A 5BW7A 3WD5H 3CVHA 4GSDL 4KPHL 5E2TL 1RK0A 3EOBA 4YO0A 1K6QL 2DDQL 4M7LL 5HI3D 1J5OL 1OWRM 5F1IA 4AG4L 5IB1B 4HFUL 2Q87A 1ZOXA 1U3YA 4LBEA 2YPLB 3IJYA 1MFBL 2FDBP 5SWSA 1QD0A 1B6DA 3QWQB 4MQ7B 4OLWL 5ERWA 4HKXA 4NNPH 1T0NA 1KJMA 1AI1L 1BOGB 5C0BE 5I0ZA 4P4RB 4BUHA 1ETZB 4YHPA 3ARGD 3BJ91 4QOKB 4L4TB 4ZTPL 4LLUB 4NP4H 1G9MH 4N90D 3BIAX 4LP4A 3V8CA 3WJJC 4KJWD 1JTPA 5IK3A 2JK5B 2VDQH 5C86A 2FX8H 3SQOH 4HUVB 2R2EB 1I7UA 1A47A 3T4YB 1Q9KA 3L3KA 4K7PL 3REVB 4EDWL 3MRJA 4OKDA 5I1LA 1P1ZB 5MI0B 4TULL 4OQ1A 5JORA 3EYVA 2Z35B 4JN1L 3VD4A 4K23L 3BZFB 3VRLE 4HBQA 4YXHH 5DI8B 3L7FA 1PLGL 3WLBB 5C09B 3SCMA 1VPOH 3DUHA 3O6KL 3QO0A 4O4YH 3NACL 5SV3A 3WS6A 1I8LC 4N1HB 4ZNCD 4PJFE 4X7DC 3T4AB 1CCZA 1QSEB 2P5WA 3B83A 1U8KA 1URLA 4PRDA 5EFIA 3VGHA 1K2DA 4K94H 2W0LA 3B2VH 3S88L 1ZLWH 5JW3H 2VITA 1JP5A 5DYOA 5IVXE 3JWDH 1U8HB 1XF2A 4FTVB 1UWXH 4X7TB 3UZEA 2CK2A 2AJ3A 3CZFA 4QRPA 5BVPH 3D48R 5EO9A 4U0QB 1VSCA 2CKBL 3BH8A 4H8WL 3P9LB 4R2GD 4WJ5A 4YDVB 2XPGA 3PJSA 3GUTB 2G75B 4LHJB 5CLWA 3WHXA 3INUL 5JIIA 1LK2B 4LF3B 4RDQG 1EZVY 3GKWH 3NH7H 1I9EA 3EW3B 4ZD3L 2X1OA 2DQEL 1X4YA 5DD1L 2CIKB 1TZHA 3S8WA 1BM3H 2UZIL 1P9MA 4FQJH 2CPCA 2XIDA 3WFEH 1AO7B 2AJVL 4PJ8D 4TVSa 5JXED 3MJ9H 4E5XB 2DJUA 4HK0A 4GUPB 1INQB 2P8MA 5KSBB 1I3GL 5CILH 5F70A 5GGTH 3EDKA 4EN3A 4HJGB 5DURD 5HGDA 1FSKB 1NGYB 3O8XD 1K8DB 2ORBL 4KJQC 1WFNA 5I17B 4C54A 1CDCA 5I74B 2GUOB 3QWOA 5GGQL 2HKHH 2XY1A 4LDEB 4JJHA 5BRZD 2GCYA 2YPLD 4NRYA 3QDGE 3ARFD 1H3PL 1Q1JH 5DSCB 2QEJA 3OAYH 3K8KA 2X4QA 5K9JL 1MAKA 2ZCLH 5ID0A 1OY3B 1S7RB 4LLWB 3DX6B 4YGVA 3RAJL 3D39B 3C60A 4LCYB 2J5LC 4PUBH 1QLFA 4P2RA 5CIPB 1OCWL 3K1KC 3FQRB 4GRLA 4K7PX 3S5LB 3HA0A 2EO1A 4JQVA 4OI8A 4HKJA 3UJJH 2NY1C 4QTHA 4GH7B 4Z76B 3BHBB 4RRPG 1FE8L 4P3DA 2V2XB 2NNAB 1S78C 2ZSVB 3HRZA 1IGCL 4LNRA 3GO1H 4HDIA 1D9KB 3N85L 2HTKC 3LN4A 2BY2A 1KNOB 1F8TH 2NXYC 1ZS8B 3UAJC 1J1XH 4WUUB 2N7BA 5C07D 3SPVA 4PG2C 1V05A 4AT6B 2D03H 3QWRD 2PTVA 1CL7I 3L3IA 3OKEB 3OKNA 3LQAH 5ANMA 3QEGL 4QRRD 1KLUB 1B4RA 1JPSL 1FLRH 3DYPA 1PKQB 3CUPA 4FQ1L 1I7ZB 5CBAB 5INDA 1OAUH 1OD9A 4PRBA 2WUCL 4HEME 5FGBA 4OCSL 4JKPL 4XRCB 3V7AG 5J3HC 4XPGH 4NQVA 3QXAA 5DJCB 1NKOA 4LLYA 2UWEA 2G9HB 1B9ZA 9CGTA 4HXBH 4XP9H 1AD0A 1KT2B 4X8XA 2DBJA 2M26A 4N8PA 5I8OH 5J6HA 3R8BB 4XBEL 1NC2B 1LQSR 2HJLA 3NA9H 2VAJA 4HS3A 2VXVH 1F3RB 2VL4A 3IFPA 2Y7QB 4U1LA 4YDIL 2Y6SD 1QLRB 4JQXC 5AUMA 3VFOB 4ORZC 1FRGH 3ZYZA 3QUZD 3SGJC 4M93B 1GIGH 1CIUA 4FQLH 1XCTA 2OR9L 1AKJA 3UYRL 2PO6D 2PYEB 4LSQL 4LASL 3JUYA 5EWIH 4OZHA 5CD5C 3VG0H 5AZ2L 3TYGH 4Y19E 1JGLL 4D0DA 1WC7A 2W9DH 1QSFE 4R0LB 2CH8A 4GKNA 2EYTB 4HWBH 1EIBA 1Z0MA 1I1YB 3C8HA 3EYSL 5KSVB 5J1AA 2DN7A 3QXWA 2AJYH 3T2NL 4E41D 1A1NB 1C5CH 5D96B 2BVQA 2RJMA 5HYJD 1FNFA 1CDGA 1MNUH 1M7IA 4M5YH 4PJDB 4PJBE 4ZXBB 4KAQH 2AJXH 1IKFL 2HTLC 1UEYA 1FGNH 3WNKA 5JDSA 3THML 1QBMH 2JJTC 4QHNA 3U46A 4N0FB 3VI4F 4XP1H 4X83A 4RDQF 1MLCA 1MFCH 5EPMB 4L8SB 4M6ML 5AAMA 5FA3A 3DOSA 1ACYL 1D7FA 2Q8BL 4JJ5B 4KHTH 2ZUWA 3BDYH 3RWIA 4X6FB 2YUWA 1V3MA 3S37L 1MIMH 1FG2B 5K33A 4OCRL 4DFIA 1T04B 4I1NB 2BOBB 4WI9A 3VXUB 5I73B 4L8CA 1B4JL 1QYGH 1TJHL 4U1MB 4G80A 1NH6A 2CMRL 3F62A 5BQ7A 2Z4QA 3MRHB 4UQ2A 1YQVH 4CMHB 4PY8J 4QWWD 2C1OB 5FYJH 4GMTH 1D9KD 4QXWA 3O11A 3DO7A 4M1DH 5DVNA 3FRUB 2VMFA 4JFFE 4P23A 5GGSB 1IAOA 3BGFC 1EHLL 4LDLB 3GMRA 4JHAH 1ZA6A 2GK0A 4L9DA 3FB5B 1TCMA 4Y4HC 4YE4L 4OCMC 1NSNL 5EORL 1JYXA 3RVXD 1UM5H 4KTDL 1OTSD 4KJYA 5EU3B 2AAVA 1TQCC 2FL5A 1RHFA 3SO3C 2CUMA 4HUXB 3B9KB 5F44A 1CD1A 3HE6A 4N8VG 4LEOA 4QY8B 4IRJC 4JRYB 1W72B 2FIKB 4P46A 5E8DH 5F1KC 3VXOB 4BQBA 4FP8L 1JNLL 4ODWA 1KENL 3F7PC 1RZ8A 1MREL 1JUFA 1NC2D 1PYWA 1P4BL 4PJ5A 3GJEA 4XMLH 3O2VH 2YKLL 4ISVB 4XTRD 3LZFH 2X4SA 1IQDB 1XF3A 3K2UH 4Y5XB 3WO4C 2X4NA 4OLZH 4LSPH 2PXYD 5D7KD 4JFYA 2AEWA 4HIJA 5FECB 1HILA 5DJYA 1MCNA 1IGYA 5HI3C 2YRPA 2VLMD 4HIHA 4G6KH 4J3UA 5CEZE 3VCLA 2COQA 4YDLC 1U8LA 3R06B 4OZIA 3IDMA 4MJIE 4UT7L 3GMQB 4RFOH 1DBKL 3OGCB 3B9AA 4XC3L 4JG0L 3V0WL 5GS0D 3BPOB 2J7LA 2RR3A 2W91A 3U7AA 1PDKA 2VDOL 3GSXB 2V2WA 1DSFH 3X11B 4QXTB 1B3JA 2FEDC 5LCVL 1UENA 3MRGA 3Q6FA 3U30B 3WS3A 2Y9RT 3M17A 4XP6L 4YFEA 5IV2A 1HNGA 3TVMD 4NQXA 2VZUA 4ZXBD 3A67H 1KTDB 4OLUL 3EYUH 4JN2A 3W0WB 3O2DA 1AH1A 4KC3B 5IJKC 3WKMH 4YBQC 3MBXH 3G6JB 5DUMH 5F8RC 3G5XB 5DZOA 1OGTB 2VAAA 1BBJA 2ICWI 3PV6A 2OK0L 5IW1A 3B6SB 3BEVA 4CGTA 5E8NB 2BNQD 5F3HB 3V52H 3TBYA 2DLTA 1R5WB 3S37X 4NC1C 3EIFA 1A6WL 4MA3A 5TF1H 3FJTA 3VXSA 2NY0B 1K4CA 4OM1H 5K93A 1UWGL 1J1OL 3GSNL 4DGYL 3PXJA 1L4IA 4FQCL 1AIFB 3PGFH 1DBJL 2A6KB 1F13A 4F15C 4OZGE 5DJZB 4U1GB 4M6NH 1GCFA 2WQRA 3CVIH 1NCTA 4MAYA 5D2NC 1IAKB 4JM4H 4OZ4A 3RVTC 4NQDE 1WWWX 3FO0L 4PJCB 4RMRA 3K3QA 4PP2B 1U8IB 5T33L 3W11D 4LPWA 3D18B 5MERA 4DKDC 3HI5H 3IS0X 2EDDA 2ADIB 5MENB 1G6RH 2VLJD 4ZOCA 4IDJL 4F57L 5EUKB 1ZLWK 5L6YH 3B9KD 2XQYK 2AJSH 2MCPL 2ICEB 3MLXH 1FYTA 4PJ8C 1FNSH 1YUHB 1S9XA 2BVPA 2VXTH 5KSUA 1J8HD 3IGAB 4FMFA 4AJ0A 5LGHL 4YHLL 4UT9L 1CG9B 2R1XB 3CDFA 4NFCA 3D85D 4HX1B 4LMQE 5D7JB 5IP4A 1DL7L 1ZA3B 2XWBA 1CT8B 2W9EH 3T8XA 5LAXB 2FX9H 1IGJA 2FBJL 5C08E 4XH2A 1MFDL 3QI9A 3AXLB 1QTYT 4QXGL 4O5LL 5GGVY 3QZWB 3KJ6H 1FC2D 1UJ3B 3T0VA 1FVDB 3BYYA 1J0HA 3ARFC 4N0CD 2D7OA 3MRDA 4JHZA 5EULV 1FGVH 4I8DA 4Z78B 4ZFOA 4O00A 4E0RA 5L8KB 2DWEA 2C3VB 3S97C 3E1F1 4ZG1A 4MQTB 2O61B 1AE6L 5F9AC 4HUUB 4PS4L 3S98A 1L6XA 4GKSB 1CXIA 4O58H 4U31A 1TCRA 1I3UA 3LRSA 2P5EE 4DZBA 3UX9B 2PTTB 3QUYB 4PREB 4XMKH 1VKXB 5EU6E 1I9RL 3H7LA 4DCQA 3MRCA 1FNEA 1LP9B 3BPLB 5F9JB 3ULUL 4OUOA 2P24B 2D7TH 1JPFA 1ZVSB 5BVJB 3TV3L 4MA8H 3VI3E 4JO3H 2JELH 4TUOA 1ES0A 3KYNA 3OAYK 5JOFB 2R23B 5IW6B 4KI5D 4Y2DA 4NQEB 2ESVB 3SCMD 2AK4E 2LFGA 4NHUA 4JY5H 3QULA 2ADGA 1EUUA 3LSOA 3GI9H 3FFCE 4I0KA 3FQNA 5C7XL 4P2QB 3MGTB 1NCDL 2BJML 3CSYA 4JZJB 3C2AH 5C0IA 1A7PH 4RGNB 4MAUH 1QVOA 2DQJL 2GSGB 4OD1L 4CVZA 5TPWL 3CMGA 1KFAL 3CPLB 4F9LC 4DTGL 4QHKI 3NIFF 1JPST 3VA2C 5C0EB 2IALB 3EYOA 2BY3A 2EE6A 3JV6A 4EIZC 1A7OH 15C8H 3ULVE 3X12B 2AV7A 2B4CC 1IJ9A 4AEEA 3F6LA 1JL8A 5GS1C 2UYLB 43C9A 2Y6SC 5F7WC 3MNZB 5DFTA 5JLZA 3C8KA 3QUZC 3V5DB 3BMVA 4MJ4A 2DKSA 2JF1A 2CLZA 1ORQA 5T3ZH 1DUZB 2PO6C 5JZ7C 5L2KE 5BMFL 4G7YH 1M7DA 2J88L 3BWAA 4G8GA 3EO0B 2ITDA 3T77A 3IAPA 2W0FB 1E28B 3WD5L 4EN3D 5GRYA 1FFPA 3BGAA 1MCQA 4NRZB 1FSKC 4HWZB 1FNLA 2BXZA 4FABH 2FZ3B 4L4VE 1SVCP 1I8KA 3OV6A 5DF0A 4JFEE 5H35A 1QO3A 2ZNXA 5EO1B 5I74C 2DYPA 1Z9OA 5JR1H 1FZOB 3MRMA 1QOKA 1EO5A 4NNPL 1S9KC 3MRFB 4MJ5A 2VR4A 3PNWA 4JFHE 5JNYB 1SBSH 3VWJB 1EEYA 1W8NA 4NP4L 1G9ML 1N8ZA 4PBWD 1CFQB 1J0JA 4N0UE 4Z7VB 3TO4B 5FUOH 4DUWA 2V9TA 4H0GA 3PIQB 4GQ9H 4UB0H 5IR1B 3HZMB 3KNBB 4PJGE 2VDQL 4ODVH 2FIRT 1CFSB 3SQOL 4ETYA 1D5MB 4ODHH 3C60D 2FJHA 5D1XB 4GMSH 4H25A 3EHBD 4P2RD 5CSGA 1A6ZB 3S7GA 1NMAH 4GRLD 2A0LD 2OYPA 4YXHL 1CGVA 1YDPB 4ZAKA 3ETBF 5HDQH 1VPOL 4GG6B 1OB1A 4O4YL 3TYFB 2ZPKH 5I1AB 3TJHD 3C6LA 5F7MC 2ESVD 4LARH 1XGQA 3DWTA 3O4LB 5E0QA 1QA9A 1D9KC 2LV4A 1PAMA 3DX9A 2CKBA 4JAMA 2VKXA 3GFUA 4K94L 3B2VL 5DJ8B 4QNPE 5DT1H 4UTBH 1T66C 3JWDL 4XHJD 2D7QA 1UXSA 2D9CA 3F7YB 3MOBH 1I85A 3RVXC 4EUPB 3VXQA 1IC4L 1OTSC 1Y18B 1PX3A 3AVEA 4N1EA 4ZFFB 3GSUB 2VISB 5DQJA 3L5HA 4XPTH 3UMTA 4IHOA 4OD3L 5JPNA 3LKNB 3V6OE 5HHOB 2W38A 4KV5F 3GKWL 3NH7L 3ZDZE 2ATPB 4YH6A 1C16B 1NDGA 2PNDA 3BW9A 4KKLC 5HPMA 4Y4KA 3TCLB 3CFBA 5KS9E 2C3XA 4I2XB 1AGEA 5IFAH 3NGBB 4DVRH 2FX7H 4FQJL 2R0LH 3KYOB 5I66B 1NGXA 4A6YL 1CLOH 3WFEL 2PXYC 1CD9B 1RV6X 5C71A 3MJ9L 4M93C 3NABH 3RWCB 5I8EB 2QTEA 3AS1A 4OKVA 5JW4N 1AKJD 3JSSA 1ND0B 1MOEA 5CILL 3QPQC 5GGTL 2IFFH 1F3DH 1KCVH 1RZJC 4P99A 3TIDB 2GTWA 1FCGA 2HJKB 4TTDD 2XWTB 3LEXB 2Q3AA