1A15A

Sdf-1alpha
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
67
structure length
67
Chain Sequence
b'KPVSLSYRCPCRFFESHVARANVKHLKILNTPACALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMAL DERIVED FACTOR-1ALPHA
publication title Crystal structure of chemically synthesized [N33A] stromal cell-derived factor 1alpha, a potent ligand for the HIV-1 "fusin" coreceptor.
pubmed doi rcsb
molecule tags Chemokine
total genus 8
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a15A00
4LMQD 1C8CA 2B2VC 5T1GA 3I90A 1DOMA 3FDTA 1G2SA 1WD1A 1EIHA 3MWYW 4O42A 1EOTA 1F2LA 2L4NA 3I3CA 5EJWA 3TZDA 5CMDA 2B2VA 1PFBA 2K28A 4XDXA 5AFWA 2HCIA 1MI2A 3I91A 2L11A 2RA4A 4IURA 1QE6A 2KEDA 4CJ2C 4CJ0B 1RODA 2RSNA 4HCSA 1WTOA 5CBAE 1U4LA 3N52A 1WTXA 1HHVA 1O7YA 4ZKCB 1WTVA 1ESRA 1F9PA 1DOKA 1F9RA 1VMCA 3GV3A 2HUGA 3IL8A 5E4XA 5JJZA 1JICA 2J7ZA 5D65A 1B2TA 1PFMA 2K05A 2EPBA 2B2WC 1F9SA 1WD0A 3MTSA 1HUNA 3LWEA 4X3TA 2BDNA 1X3QA 1ILPA 1BNZA 1WTPA 1TVXA 2Q8RE 1MGSA 3UI2A 2FFKB 4OIKA 4ZAIA 2B2WA 2R3ZA 5EPLA 1J9OA 1O7ZA 1WTQA 2B2YC 1RTOA 2JYOA 4DN4M 1BO0A 2XIWA 4XT1B 5EKIA 4MHEA 2L12A 1AZPA 1CA5A 1WTWA 1WVLA 2B2YA 3TN2A 1G91A 3R93A 4IUVA 4X3KA 1EQTA 1HFNA 2IL8A 5T1IA 1B53A 1X32A 2FJ2A 2KVMA 2KUMA 2MGSA 1DOLA 2DY8A 2FINB 2N55A 4IUQA 4RAUC 4RWSC 4X3SA 5DNFA 4IUTA 2FHTA 3IFDA 2HDMA 1JE4A 2K04A 2CVRA 4QUCA 1F9QA 5CBEE 1HRJA 4IUUA 1ML0D 5EPKA 1NR2A 4U68A 2KOLA 5D14A 2X6LA 4UAIA 1U4MA 3FPUB 2VXWA 5E4WC 4RA8A 1MSGA 1M8AA 3H91A 1QNKA 5COYA 4QUFA 2HDLA 2K01A 1WTRA 1DONA 2X6GA 1A15A 4ZKBB 1PFNA 3KBXA 1HFGA 5EQ0A 2SDFA 2L9HA 1J8IA 2M2LA 4ZLTF 1ILQA 1KNEA 1U4PA 3F2UA 5CORA 3SVMA 1NCVA 3I8ZA 1E0BA 4R9WA 1RHPA 1O80A 2K03A 1Q3LA 2NYZD 1AP0A 2RSOA 1IKMA 2EOTA 2B2UC 2FMMA 3G7LA 2B2TC 1X3PA 1NAPA 2MPMA 4CJ1B 1AZQA 4ZK9B 2K1BA 1DZ1A 1SDFA 3Q6SA 1B50A 2D9UA 4NW2A 4HEDA 4XT3B 1LV9A 2B2UA 1CM9A 1VMPA 2B2TA 1CA6A 3DEOA 1SSOA 3D6WA 4IUPA 4X3UA 4R8IA 2HCCA 3P7JA 4MN3A 1IKLA 1KNAA 1U4RA 1XYIA 1ICWA 1GUWA 2JP1A 2H1EA 2KECA 2MJ8A 3HP3A 1B3AA 2DY7A 1RJTA 1EIGA 1SAPA 2KEEA 2MP1A 1HA6A 2L1BA 3ONAB 2RVLA 1NR4A 1RTNA 2N88A 3GV6A 1B4OA 1G2TA 1HUMA 4HSVA 4OIJA 2Q8TA 2NZ1D 1S4ZA 3DM1A 3DEPA 3KUPA 1QG7A 1ZXTA 2EE1A 4HAEA 5EPJA 1BBXC 1EL0A 2NWGA 1IL8A 3QO2A 2X69A 1PDQA 1BF4A 1G6ZA 1PLFA 1XX8A 1MSHA
chains in the Genus database with same CATH superfamily
4GKKL 4JI5Q 3FEWX 3I90A 1N34L 5IP7H 3FMCA 3T53B 2L0CA 5C3EG 3KK7A 3RNUA 4HJ9A 1IBKL 4UP7A 3GTJH 2R92G 2A73B 1FYCA 4ZCKA 4AYBE 4A3DB 3SXHA 3C2PA 4X65Q 3S2DB 5L37A 4ZKCB 2RF4A 2HUGA 4ZYSA 2J0TD 2B2WC 5C6AA 5CV7A 1CHPD 2DN8A 2Q8RE 3UI2A 1GOZA 4CBVA 2YV5A 4XYQA 1CKNA 4B3MQ 5C3XA 1UAPA 5EKIA 3TS0A 1EZ6A 3AMUA 1FGBD 3HKZE 3NPPA 1X32A 3MFGA 2VS1A 4RAUC 1EU4A 4I65A 5KYLA 2G9HD 2WB1B 3KDFA 4UP8A 4NXNQ 1Q46A 3TBIB 1KAWA 1ML0D 4JI5L 2A6HD 2JEBI 5E4WC 1CHQD 2F03A 1STEA 4B08A 5K36H 4DAYB 2IJ0A 1EQQA 1QJOA 5ELDA 1PV4A 3SVMA 2F52A 2K7VA 5C4JH 2IY5B 1SMXA 1O80A 2NYZD 1SYCA 3OTOL 3I4MB 4X6AH 2A5HA 1BR9A 1NAPA 2MUYA 2Z6BA 3EROA 3HEJA 5M3FH 1RDPD 1SDFA 5IYBH 2C9OA 4KHPQ 4AQYQ 2R61A 1JOOA 5I9PA 1K28A 3QWNA 4IALA 4B3ML 3MEFA 1QCBD 1UNSA 2LMCB 2Z8LA 1J6QA 2E2JH 5M5WH 4NMZA 2IHFA 4K0KQ 2NN6I 5C4HA 4NXNL 1OXXK 1TWGH 1XTCD 4ILWA 4DXFA 4FVMA 2E76C 4GOPC 3A8IE 3T13A 3J7AF 2A74C 4DNRB 2JA5G 1GHJA 1CZWA 1CFMA 1HR0Q 1B70B 4RMFA 1X55A 2WB1E 3OPOA 1BF4A 4RCOA 3AB9A 5KNBA 4IQZA 1E1OA 2EYHA 3CPFA 4KY5A 3S15H 4WJWA 3RN2A 4JCVE 5FLMG 4CJ2C 2N8NA 4P74A 4N8FA 1KAAA 4HCSA 5DEHA 3M4OB 1C4QA 2F0KA 4KHPL 4AQYL 2R93B 2K05A 4KJNA 1MGSA 2ZTDA 1R9TB 2PI2A 1AE2A 4NPSA 5J22A 3RZDB 4K0KL 4XXEA 1QVGA 1PH2A 4IFDI 3S1MB 3BJUA 4FF1A 1CI3M 4F87A 1AZPA 1PTOF 4KD3A 5ELNA 2PQEA 1M90C 5GROA 3BVZA 2AWNA 4JOIA 2Z4IA 1HA5A 4K8JA 2B8GA 5M9OA 1HR0L 3HOVH 1HQRD 2KHJA 4JPBW 3Q23A 3VR6A 4MIUA 1LTID 5D14A 2B8FA 4ZRZA 5JVH3 4GOPB 4PG3A 3JC66 4RFBA 1AW7A 1A62A 2R7DA 3Q0AA 1JMCA 1LUZA 1LT4D 2CFMA 3S17B 1TS2A 2AQ3B 1DCZA 1Q8KA 1S3OA 1XPOA 1NCVA 2XVSA 4A93H 5IP7G 3CMAA 1IKMA 2JA9A 1PXUA 3MZ5A 2HD3A 3Q6SA 4DPGA 5M3MB 1GO3E 1CK1A 3HOWB 1LLRD 1X54A 4A3EH 3W2DA 1PYWD 4WRDA 1WCMB 1VQ6A 3D6CA 2YTYA 2MJ8A 4C3JB 1C48A 4TSSA 2N78A 3W5OA 3NBIA 4HJ5A 4DUZQ 2V4DA 4LAAA 3ND9A 4I7ZC 2LSSA 1A3VA 2EY5A 3CQZB 3DEPA 3FVQA 1VQ9A 3R8BA 4JI7Q 4DNTB 4JI8Q 1G8ZD 3HOYH 3ZYYX 1G6ZA 4V190 3OW2A 2UUBQ 3J81j 4Q0FA 3K7AH 1EIHA 3A54A 4B9WA 1JCKB 3SK4A 2Y0SG 3OMGA 1SYGA 2NVTH 1PFBA 4GN5A 2RDFA 1I5FA 2KHIA 3WOEA 4FP5D 1UEBA 4BY1B 1BBWA 1N32L 1SEBD 4FF4A 4LK1C 2CQOA 5K36G 2DNCA 1XMOQ 1TWCB 5IGCA 3NQTA 3LWEA 1X3QA 5J1ZA 2E2IH 1ILPA 2NUCA 2NBFA 1K0RA 4GN4B 5KGUA 3DWPA 4UP9A 3RMHA 1VQEA 5I6WA 5M3FG 5IYBG 1STHA 1VQOA 4DUZL 1WVLA 1HNWQ 4DUYQ 1NJIC 3F2BA 1K9MC 4GKJQ 3NE5B 1ZKOA 2RCNA 4A3LH 4IUQA 1H9KA 2K14A 4XQJA 4JI7L 4G4KA 4JI8L 5CBEE 1HRJA 2EVBA 3CMEA 3EQLC 3NQIA 2UUBL 1N8RC 3BYTB 1WOCA 2HIXA 2K4KA 1VQNA 5I9OA 2K33A 1K8OA 1EY4A 1SE2A 1CKNB 4JI4Q 4RHRA 2JA6H 5C44H 1I6HB 4JBKA 2F0PA 3UDGA 4DK1A 1I4XA 1UE5A 2MO1A 3G4SA 1XMOL 1PA6A 1HFNA 3G7LA 3KDFB 5IIFA 2KCNA 3CPWA 1HJPA 1N33Q 1KLUD 3MFYA 4GNXC 2WKCA 1PH9A 3DEOA 1SSOA 4L5SA 3KF6B 1GJXA 4DU9A 4LF5Q 3LGJA 1XYIA 3PSIA 1HNWL 4DUYL 2JP1A 3M4YA 2BA0A 3TMEA 1E2VA 1D7QA 2K52A 4GKJL 4FNFA 5C4XB 4FDBA 1VQAA 2ZXPA 1LYLA 1HUMA 3DM1A 2XNAC 1VQDA 2JA8B 1CSQA 4DK3C 3J80c 4OO1I 1BOSA 3SHLA 5FJ8H 4KKTA 5LMNQ 4JBMA 1I3QB 4R4TA 2VUMG 4A76A 1SR3A 4KMUC 2JK8A 4JI4L 3HOVG 3GTGB 4TRDA 1DXMA 1UE7A 4M8AA 4Q5VA 2EJGC 2MNAA 2CCZA 1JJCB 2NN6H 2YTVA 5FLXL 2F0GA 4PQXA 1VCIA 4B3TQ 2WP8J 1UUPA 1KDCA 1EY9A 1N33L 2DJGC 1K8MA 1NE3A 4CDFC 3MXGA 3U58A 1H95A 5CV8A 2LS01 4LF5L 1W2BA 4A93G 1VQPA 2SEBD 4LWCA 1JWSD 4A3KH 2JYOA 4Y52H 4DK6C 1WTWA 3JAMi 2E2HH 3ULPA 1KQSA 4LUZA 4C3IH 3QIAA 4A3EG 3KLWA 4X3KA 3G48A 1U5KA 3IFTA 2JEAI 1BCPC 3CU7A 4A3IH 1SNCA 2CVRA 1K3RA 5LMNL 2PNRC 3HRZC 2YU9B 3BYYB 1CSPA 2WAQB 3SK8A 3KLSX 1JC7A 2KCMA 4DXGA 4RA8A 1PTOH 3OOCA 4QUFA 5IGBA 4PMBA 4P71A 5IYDH 4ZKBB 2L9HA 1J8IA 3HOYG 4YCUA 2M2LA 1YZ6A 1Q7YC 4JI3Q 1HZBA 4B3TL 2XTIA 4KLKA 1NBWA 2E5LQ 3OIQA 1IL2A 1I4GA 3GTMB 4L6TB 1I4HA 1HR0W 3NTIA 1TY0A 2R7ZH 5GAGC 4LNQA 2D9UA 2AUKA 1OXTA 2D0PA 2EYJA 4JI0Q 4CHTB 2B2TA 1V1PA 1ET9A 3CCQA 4JI2Q 3J80E 4CDCC 2Z6KC 2HQEA 1GUWA 2KECA 4DAMA 3CCJA 4OONA 1TXYA 3HOXH 4YY3Q 3I4NB 1AE3A 2F0JA 2A6HC 3BU2A 2EE1A 2NWGA 3HOZH 2OXPA 1I50B 3VR4A 4A3JH 3VA5A 3GTPH 4YWLA 1ET6A 4DV4L 4A3LG 3FDTA 1TS3A 4WJ3M 2WAQE 1Q82C 2F0HA 4JI3L 2K28A 1Z7TA 1MI2A 4DV3Q 2L11A 3A7LA 2E74C 2PI2E 2E5LL 1XPUA 1RODA 3W1BA 1WTOA 1FNUA 3H0GH 3N52A 3S14H 4OWWB 2K75A 2KJXA 4QB4A 5IY0A 4JI0L 2NVQB 2JA6G 5C44G 1W3SA 4X3TA 2BDNA 1YHBA 4JI2L 4KN7C 3QG1A 1NY4A 1PZID 4A75A 2FFKB 4ZAIA 1EY5A 4NP5A 5JEAH 4DN4M 4PNYA 4RGOS 1Y1WB 4XT1B 1Q81C 1Q1EA 2CWPA 2IT1A 2JA7B 4YY3L 5AJ3L 3I55A 1TWHH 4AH6A 4BY7B 1DOLA 2PQAA 3I72A 3IFDA 1D1KA 2K6AA 5TSSA 1NR2A 3CRKC 3V96A 1H9SA 3RLNA 3K6OA 4U68A 1N36Q 1NNXA 3NHHA 4L5RC 3FPUB 1QVFA 1KIXA 3UE1A 3X3MA 1K3BC 5G3LF 1B9NA 3D4DA 1JB7A 3DWQA 4DV3L 3KBXA 2ZXRA 5KNCA 2MO0A 5D3IB 2VNUD 1K8GA 1SNOA 4DR6Q 5FJ8G 1D5ZC 2P5ZX 1E0BA 3HOUB 4DV5L 4K8IA 3K0XA 3NEMA 4A3BH 1X3PA 4C1NI 1DZ1A 5C0XI 1XXGA 1EYDA 2NN6G 1J5EQ 3GD7A 3IKJA 2L15A 4CDEC 2XWBB 2KBNA 3DLLA 4GKKQ 2H1EA 4DV2Q 3HP3A 1B3AA 1HA6A 1VQMA 5DM73 4RH6A 4C3HB 4A3KG 2D2CC 3RZOH 3S2HH 2TMPA 3M4QA 1KDAA 1QG7A 1UE1A 4HAEA 5EPJA 1N36L 2E2DC 5JJLA 4A3FB 4B3RL 1K73C 4UPAA 1STYA 4C3IG 4A3MH 1D2BA 5A35A 4LF6Q 1E24A 4J15A 5IT9L 5D3DA 5EBDA 2F0FA 4A3IG 5KNDA 4DR6L 1FGUA 2XGTA 1KC8C 1LM0A 2HCIA 1WFQA 2KHSA 4R4IA 4BBRB 1VQ4A 2QILA 5JOBA 4LF7Q 3MEHA 1HHVA 2BH8A 1WTVA 5IYDG 1BQQT 3STBC 2FMCA 1EIFA 3KF8A 2WACA 1L2FA 1TKWB 1ZEQX 3PIOA 1WTPA 2IX0A 4BBSB 1GM5A 4JYAQ 4DV2L 1WTQA 1GUSA 1TWFH 5IE8A 2R7ZG 2JE6I 3C3LA 3GTQH 2B2YA 1A3UA 3NXWA 2NVXB 3S1RB 3P75A 1OXVA 1CKOA 1EQTA 1SJHD 2Q2HA 3PO3B 5IGFA 3K5LA 1YI2A 1SFOH 2OTLA 1JOQA 1JWUD 1Q1BA 1EYCA 4KY6A 3OTOQ 3BZCA 3HS0C 1Q12A 3MC0B 4LF6L 1O7LA 5JPNC 3EJIA 4G7ZC 2EQSA 3HOXG 2PYKA 3JAMc 1EYAA 1QNKA 5GADC 2B63B 1A15A 2H5XA 3HOZG 4A3GB 5EQ0A 1QUQA 5ELOA 1BVSA 4JI1L 3OWFA 4A3JG 1EY7A 4GN3B 1ILQA 3F2UA 5CORA 5CV6A 4LF7L 4EX5A 3I8ZA 4R9WA 5IGEA 3PF5A 1CT1D 3M3YB 4FXKC 5BN3A 3GTLB 3S1NH 3S1QH 2AHOB 4KV6A 1O7IA 1G291 3E0EA 1PRTF 2B2UA 5LMNW 1VMPA 1X3EA 1YJWA 4JYAL 3I4LA 2OWOA 3H0GG 5C4ZA 1AFPA 1G6PA 1Z9FA 1VQHA 4KTAA 1RJTA 1GUNA 1SAPA 5CV4A 5EKLA 2L1BA 4FXGC 1S5BD 3BDLA 4LFAQ 3NWTA 1PH4A 1KRSA 5JEAG 3KFUA 1SE8A 3CHBD 3MAQA 5G3LD 1V1QA 3WWVA 1K83H 3WOFA 1E2WA 4JW0A 2PO4A 2VW9A 2D62A 4ZQ3A 4H0LC 1TR5A 1RKNA 1V1PB 3PUZA 5KIXA 1GXDC 2K5WA 2OCEA 4GZYC 1N9WA 2V1CC 2NVYH 1Y8OB 1L1OA 4ID6A 3U4VA 3QOLA 5CBAE 2GN5A 2BE5D 1II3A 1F9PA 1PZJD 1EQVA 5ELFA 3A7AB 2EPBA 3L2PA 1MHWC 4PZ6A 3A74A 5NUCA 5K5PA 1RIPA 1Y1VH 2G9DA 3H3VC 1HH2P 5EPLA 2FXQA 4DV1Q 3MXUA 4A3BG 3QR8A 4KHVA 3VYUA 4LFAL 4EGVA 3AU7A 3J81c 1T5XD 1EY6A 2QKIC 5M5XB 1SNMA 1HNZQ 3I73A 2FINB 3NSWA 3TQYA 2RDHA 1L0YB 4OXPA 3ZJYC 3S9WA 5J3BA 1EEFD 1IW7D 4JBWA 3U9OA 1LT3D 4JV5Q 2PZUA 3PO2B 3FKIB 3GP7A 4H44C 5ISRA 4P73A 5BR8Q 2A69C 3EN2A 1I4QA 5GAEC 4A3MG 2EY2A 1EWCA 1HQMC 4Y7NH 3F2CA 2FMMA 3L9AX 5FO7B 4DFAA 2PQAB 5DLQE 4CJ1B 1YNJD 4GLVB 1HZ9A 2F0MA 3SK5A 3HZXA 1B50A 1LV9A 3E5SA 1PH6A 4DV1L 3G71A 1H9SB 1JOKA 4IUPA 1EY0A 1GD7A 1DD2A 3DXJC 1VF7A 1KNAA 3H3VI 1EIGA 2MP1A 1HNZL 1KABA 2EXDA 2F0LA 4PMCA 1KL9A 1U9RA 1VQJA 1EU3A 2N88A 4J1MA 1CTMA 1EY8A 2GA4B 3M4PA 2DNEA 3NENA 3WDNA 1N32Q 3LNNA 4YIJA 3D31A 5C3EB 3QO2A 4JV5L 1PDQA 4TVAB 1PLFA 3PCOB 1KTKA 5M5YH 2CW0D 4C1NK 2R92B 1F2MA 1U0LA 5BR8L 2QEJC 3TZDA 2B2VA 5JJKA 4K5VA 1PRTD 1JB3A 4C2MH 3S16H 1ZYRD 3J81E 1EOVA 4HIMA 1O7YA 4GS3A 1A2UA 4RGTA 4TQUS 4HCEA 5LL6X 3DUZA 1DM0B 3RUZA 1TS4A 1Y8NB 3TDQA 2LY7A 2UU9Q 1P16A 1QB5D 1YVCA 1G51A 2J4XA 1SE4A 2A19A 4QL5A 1TVXA 1K8AC 1I4RA 3SDZA 1EFID 3VR5A 1O7ZA 1HCZA 2F0UA 5LHY1 1XNQQ 4DV0L 3OHXC 1B9MA 1KXLA 4YWKA 2CQAA 2FJ2A 2F0OA 4RWSC 2Q2IA 2FHTA 2IWHA 2K04A 5BN4A 2A68D 1YITA 3OWEB 3D4RA 1HZCA 2WINB 4X64Q 1JQYD 1TU2B 3KF8B 4FF2A 3ER0A 3TS2A 1K0SA 4R8NA 2ICEC 1BBUA 4L8JA 3GTKB 1KNEA 2VQEL 2BDOA 4ME3A 2K03A 4A3DH 1VQ7A 1VQ5A 5I4DA 3S2DH 2F0QA 2UU9L 5J39A 3F8TA 4KKSA 4NW2A 3K8AA 1SLJA 3T1YL 1A2TA 1H9MA 1XNQL 1SYDA 2QW7A 2RHQB 5IP9H 2JJQA 3BVMA 3SEBA 4DR2Q 5EKKA 3H94A 3G6JB 2JA5B 4A4IA 4XYOA 1QUQB 1Y1VG 3GTLH 4BXXH 3KUPA 4WORA 1ZXTA 2K5NA 1NUCA 1FNVA 4X64L 2AMCB 1PVOA 1A63A 5KEEA 4DV7L 2EYLA 1PTOD 3URYA 1BXTA 2AQ1B 2NTTA 1MJEA 2VQFL 1G2SA 2M00A 1F2LA 3I3CA 1ENFA 3AEVA 3Q22A 5ELEA 1QE6A 1C9OA 1HTPA 2IPKD 3BG3A 2AUJD 5DAUA 4CKBA 5IYCH 1WTXA 3I4MH 3T1HQ 2CKZB 1W6JA 5CYUA 3GTOB 4OGQC 1PFMA 4MTKA 2PW7A 3E9IA 1WD0A 3TZUA 3V05A 4RG1A 4DR2L 3GQBA 1PH8A 3CP0A 1MD2D 4MHEA 3BZDB 4JOIC 3K7UC 2A6EC 2M9VA 3CD6A 1LTRD 2EJFC 1IBMQ 1L0WA 1SJED 2N55A 1RD9D 4B9XA 1S5CD 3BZKA 4DR7Q 1YIJA 1B44D 2DUDA 3RLFA 4JI6Q 3PUYA 2OTJA 3F1ZA 1ASZA 4UAIA 3E3XA 4PZ7A 5IODA 4KY7A 5HURA 2X6GA 4BWGB 3VYSA 1SRUA 4CKEA 2RKSA 5M5XH 4HJ8A 2AKWB 1U4PA 3GTJB 1X6OA 3T1HL 3M4OH 1JE5A 4RGMA 4J8QA 3NBHA 2EOTA 3HKSA 4AYBG 4M1UB 4YWMA 2ZJRA 2R93H 1PHJA 1TQOA 4POGA 3EFXD 1VQGA 1FR3A 4R4CA 1HNXQ 3FKIH 5E7NA 1R9TH 3CCEA 1SBBB 4PMWA 4MN3A 3RZDH 4DV4Q 5IOCA 3S1MH 1WJJA 2O4XA 2F0NA 1IBML 1SMYD 4IFDH 2AQ2B 1RTNA 2EZVA 4ABNA 4DR7L 3PGZA 1SXTA 3PUXA 1S72A 1ONLA 3HKZG 1LTBD 3E6ZX 4KN4C 4JI6L 1PYSB 2XRQD 2Y0SB 3RN5A 2LFNA 1DYQA 3Q8DA 4YCWA 5T1GA 3H15A 2I46A 2K5DA 2QDBA 4PZ8A 3S17H 3H3VH 4L5TA 4DR5Q 2K50A 3R2TA 3BDCA 2HIVA 1EYGA 5AJ3Q 1EZ8A 5E4XA 4ULLA 1X3FA 1JICA 5M3MH 1F2ZA 5M3FB 1QZHA 3RR5A 1HNXL 1V1OA 3HOWH 4K6DA 5GAHC 2BA1A 2JSOA 1BNZA 1S5FD 1WCMH 4A3DG 4DF7A 2B2WA 4QQBX 3PIO3 3PV0A 3TRZA 4C3JH 1BCPF 1LT5D 2E2JB 5M5WB 2XN9C 4IOAA 1RF2D 1VQBA 3EVQA 3R93A 4HJ7A 4H02A 1TWGB 1B53A 1SNDA 5IP9G 1A8VA 1PYBA 2DY8A 4ZUJA 4WFN3 3CQZH 5A2QE 1XTDA 3OIPA 1STGA 4KK7A 4NXMQ 4DV5Q 4QUCA 3VR3A 5EPKA 3CKIB 1M4VA 3P20A 3PIPA 2WB1G 3GO5A 2Y0SE 2K01A 3KLSA 4BXXG 4BA2I 2F1MA 4DR5L 2I5LX 2F0IA 4HR7B 1HFGA 5IGGA 3J7YW 1IYJB 4I7AA 2BE5C 2IW3A 4K6LA 4BY1H 3PF4A 3D4WA 1YNND 1B1ZA 3J80L 5IWAQ 2Z4HA 1A3TA 2G5DA 2Q8IB 3DMUA 1JWMD 4TKOB 3M85A 1VQ8A 1M1KC 4ZK9B 4L63B 1TWCH 1D1IA 1X65A 5CGKA 5C3WA 1JR0D 3SGIA 1AEXA 1KLGD 1FL0A 4B3RQ 4EVOA 3I4MG 3AYHB 1VQFA 5FKAC 2EIFA 5IYCG 4NDXA 3H09A 1MKHA 2KEEA 2IX1A 1HXYD 2B3GA 1H9JA 3ONAB 4IZ8A 3NWSA 3EBEA 1OO9B 3GV6A 3TP5A 4NXML 4OIJA 2VUMB 1S4ZA 3HOVB 3W1GA 4QCLA 2NB0A 3CCVA 4GOPA 3U50C 2Z9HA 1VQCA 5EBCA 2R3ZA 4R8IA 2ZTCA 3ULLA 3MXNA 3UDIA 4HIKA 2O5JC 3L3OC 4QJFA 1JJGA 4B3SL 5CMDA 1I6HH 3EIVA 2K5QA 2EY6A 5IWAL 4CJ0B 1Q8IA 1YNJC 2DGYA 4A93B 2CH4W 2BOSA 5ELCA 3U9SA 4V0BA 1XWEA 1HUNA 1PH3A 3K5MA 4A3EB 2WKDA 1E1TA 2D5DA 3K81C 1VDZA 4EQ5A 1CQFA 2C35B 3PUWA 2R93G 4IN3A 3TN2A 4JG2A 1VS0A 3M7GA 3FKIG 5C4XH 5T1IA 4JI1Q 1WYDA 2HT1A 3SK6A 2ZM6L 2JA8H 1F9QA 3VR2A 4N8X1 1UWVA 4IFDG 4DAVA 4JVZA 3CCRA 3HOYB 2PCFB 3H6MA 4IPGA 1I3QH 2VXWA 1BDOA 4OO1H 1MSGA 3H91A 5HY6A 2ICIA 3K7AB 1PRTC 4HJAA 3GTGH 3TREA 1O78A 1PH5A 2NVTB 1PFNA 3Q24A 2PMZB 3MXPA 3FHWA 3NTKA 1ZYRC 4EQNA 3J7ZC 1NTGA 3VDYA 4IPDA 2JN4A 2SOBA 4IJLA 2B2TC 5JPMC 2MPMA 1AZQA 3FP9A 2L55A 3ERSX 4HEDA 1CUKA 1OXUA 1F77A 4DK0A 2A8VA 4HSPA 2E2IB 2PZWA 2F3VA 2ENBA 5F2DA 5JVG3 1XJVA 3P7JA 1LTGD 3HGBA 4GLAC 3DM3A 3KYHC 4S3SA 3V2TA 5M3MG 3HOWG 1SNQA 4HIOA 3C1FA 3I2ZA 2QEXA 1WCMG 3KJPA 4R4QA 1EQRA 2A68C 4WJ4A 4C3JG 3NBHB 5GQOA 4DKAC 1VQIA 1EL0A 1VQKA 4NKLA 2YU9H 4DA2A 2CHBD 1F2YA 1MSHA 2EYFA 1GVPA 1VF5C 4IPCA 4F7XA 1I6VC 2ALYB 4O42A 1EOTA 2L4NA 5H1SE 1V9PA 3IAYA 4XDXA 2R7FA 5EAYA 4OX9Q 2JA6B 2GVBA 3I7FA 5C44B 4FO2A 4RCNA 1PRTB 1U4LA 2F0DA 1D6EC 2PMZE 3GTMH 1ESRA 1L0XB 2PW5A 3KF6A 1MJCA 2EDGA 4OWTB 4BY1G 4F88A 5FOBB 2Q2TA 2YYZA 1STBA 2EJMA 3P1HA 1J9OA 4IO9A 4O0AA 1RL2A 1BO0A 1PZKD 2XIWA 1QILA 1EFWA 4XQQA 2L12A 2OQKA 3D0FA 3QJYA 1XPRA 4X65L 2BH2A 4FXDA 4XTCS 2IL8A 4HIDA 1WTHA 2KVMA 1CA5A 1CKMA 3I4NH 3OMCA 1TWAB 1QOHA 4P2CB 1PTOC 1R4PB 4DGZA 3LX0A 1I50H 4CKCA 3AFQA 5FO8B 4QGUA 1XNRQ 3B6YA 1U4MA 4DR4Q 4MNOA 1IBLQ 4X62Q 2OT2A 3J80i 2QA4A 2NZOA 1WTRA 4OX9L 4OL7A 1QZGA 4KHZA 1ESFA 4YCVA 3JAME 3I70A 2UXCQ 1FNWA 4G7HC 1E7ZA 1SNPA 1S5ED 4DV6Q 4IOCA 2I5MX 4G57A 3TEHB 2C5CA 2NVQH 2ZJPA 4OHJA 4XT3B 1Z47A 2QGQA 3PMFA 3SE0A 1V8QA 2F3IA 2HCCA 4APVA 4GNXA 3X3NA 4A3KB 1NMFA 1Y1WH 3TP6A 3J7AV 2E2HB 2JA7H 4C3IB 4BY7H 2OEOA 4RKLA 4HSVA 2MQHA 5CV9A 4A3IB 3M7NA 1YNXA 1XNRL 1W6KA 2YTXA 3ND8A 1VQLA 4DR4L 2O5IC 1IBLL 3BDOA 3U4ZA 4X62L 1DGSA 1B7YB 4OELB 4IUNA 1KD1C 2UXDQ 5C4XG 4LFCQ 1I4PA 3ULJA 2VZAA 4JK1C 1PTOB 2F0WA 3QB3A 3MWYW 5EJWA 2JA8G 1T9HA 1BKBA 2UXCL 4DR1Q 2JQOA 1PFSA 4MZ9A 3I91A 4DV6L 4IURA 4DV0Q 3KBGA 3HOUH 4OO1G 2RSNA 4Z9CB 1YHAA 3K57A 3A55A 2VUMH 3SR1A 1B8AA 1NMGA 2ZT9C 3A8KE 5E3FA 3JAML 2QF7A 3BS1A 5D65A 1FD7D 2R7ZB 2IHEA 1SYBA 5C0XH 1YHQA 3PUVA 4LUOA 3CW2C 3MXNB 1SMYC 2B2YC 1HPCA 2UUAQ 4C56C 2I5HA 4R1JA 3C1EA 3VYTA 3R2IA 4LF9Q 4HMIA 1UE6A 4LW1A 5I6YA 1IXRA 4C3HH 3K59A 2KUMA 3HOXB 2I07B 5EGTA 5DNFA 2VQEQ 4IUTA 4ME5A 4O1NA 3KOJA 4A3FH 4IUUA 2UXDL 1SYEA 4FYDA 4LFCL 3HOZB 5FLXc 2RDGA 4A3JB 3STBD 3DHQA 3GTPB 2X6LA 2KCTA 3GDEA 4IFDJ 1GUGA 1OXSC 4ALPA 4DR1L 4UHVA 3T1YQ 2SNMA 2Z0SA 2QDLA 2WAQG 3LWUA 5I2XA 1D5XC 4BBRH 1CZGA 5JAVA 3CC2A 4RGNA 2KENA 2KQ3A 1E2ZA 1TY2A 3H0GB 2K32A 3S14B 2B2UC 1B2TA 1BUVT 2B39A 2KA7A 3NUCA 5HGTA 1IYUA 1LTSD 1PMRA 2EYOA 3IRBA 4HN7A 1X3GA 5KRUA 4BBSH 3OSOA 5CC4A 2UUAL 4DV7Q 1ICWA 4LF9L 1YBYA 4F8MA 4PV1C 2DY7A 2VQFQ 5C5LA 2NVXH 2Z6KA 4QF4A 3S1RH 1NR4A 1T5EA 1Y8PB 2ZTEA 5DM63 3PO3H 1TWHB 4E6IA 1SYFA 1JORA 2VB2X 1B4OA 2F4VQ 2RQXA 3A0JA 1C0AA 1KDBA 1BBXC 3L7ZC 2F0TA 1Q86C 1IL8A 2IX3A 3J7A5 1LTTD 3NELA 4DAPA 3J81L 3I4NG 4K5WA 1GHKA 1L1OC 1WD1A 2ATWA 4K2KA 2B63H 4A3GH 1Y14B 1YNNC 4G7OC 1FJGQ 4H13C 2RA4A 3K58A 3M3YH 4X66Q 4IPHA 1DJRD 1C7YA 1PH1A 2PNHA 1PH7A 1VMCA 4A3BB 1CQVA 4OEMB 1ENCA 1A0IA 4HMJA 5LMUQ 2EYMA 3EA6A 3ERQA 3NK9A 5JEAJ 3M9BA 1Z6HA 5FLXE 4L5QA 4LUVA 4KKUA 4DR3Q 1STAA 1EWHA 3I56A 1LT6D 3AFPA 5HGQA 4ZUIA 1G91A 4XQNA 2F4VL 4EQPA 3F2DA 2MGSA 1C8CA 3RZOB 4JBJA 1Y1WG 2ES2A 2HDMA 3S2HB 2QCPX 3C46A 1GUTA 4JC0A 1LACA 2JA7G 2Z1CA 1HZAA 3TSSA 2NZHA 2KOLA 4A3MB 2OQ0A 4BY7G 1AH9A 2F0SA 1DONA 1FJGL 3PIP3 1A6XA 1UEAB 4QMGA 3T4AC 3CF5A 1LTAD 4ODGA 4X66L 2Q2UA 3MVVA 3DWAA 3T56B 1L1OB 1RHPA 1Q3LA 1TWAH 2DJFC 3E9HA 1GKHA 2RSOA 4BA1I 5LMUL 4LF8Q 2TSSA 4DNIA 4OWXB 2K1BA 3E0JA 2F3WA 5FO9B 1QNUA 1CM9A 3HOUG 1D5MC 4A3CH 4DR3L 2OF1A 3K5NA 1FVIA 1AN8A 4O2DA 1TWFB 1EUJA 3NTHA 3VA7A 4NB3A 4CDDC 3GTQB 5C0XG 2XWJB 2A69D 3D3RA 1G2TA 2Q8TA 1SFOB 3A5UA 4QIWB 1Y69U 3L0OA 2VY3A 3O13A 3ICEA 1EIYB 3BVGA 1EWIA 2N49A 3G6EA 4RHSA 4C3HG 2CWAA 4LMQD 2WFWA 3PO2H 2L5TA 2B2VC 3A5ZB 4J6HA 1LTLA 1IYVA 3K0YA 4GNXB 4A3FG 2F0EA 1E22A 5I2YA 2KEDA 4N9PA 1JT8A 4LF8L 2H4OA 4MTNA 3OYYA 3S1NB 2E75C 3S1QB 2UXBQ 2J7ZA 3OW7A 3QOJA 3MTSA 4XIGS 4BBRG 1MBYA 4LJZC 4UDUC 2PPBC 4CGYB 4OIKA 1SE3A 2O2LD 3NP8A 4DAYA 3CRLC 1RTOA 2VL6A 4UY8C 4YHHQ 1TS5A 3KJOA 1IZ6A 5IT9c 4IUVA 4BBSG 4BS9A 5C4JB 3VYRA 3CCMA 1K83B 3RD4A 5C3EH 1P8LA 3UDFA 3CCUA 1QWYA 1GUOA 1OTCA 4AIMA 3PO3G 2GVAA 4QIWE 2R92H 2JXMB 4R4OA 2XSCA 3HFZB 1YJ9A 5ELBA 2NVYB 2WIIB 2ZJQA 3D8GA 1X56A 4ZLTF 4QY7A 4KJOA 4POFA 4P75A 4EQOA 3A8JE 1I94Q 2UXBL 2LXJA 4U673 2B63G 1H9RA 2E8GA 3N6RA 5CR3A 4A3GG 1B3QA 1ICFB 1Q90A 3K80C 1WI5A 2RBMA 1BCPB 4K2LA 1Y1VB 4X3UA 2VB3X 2EY1A 3FPPA 3T51B 4RKBA 4YHHL 4LFBQ 1YJNA 5FK9C 1YEZA 2K5VA 3S15B 2RVLA 2EXZA 2ZXOA 1KHIA 3TP7A 4B3SQ 1IHZA 3T16A 5IGDA 3AQQA 3J81i 1XMQQ 2NZ1D 3HG9A 3CC7A 4K14A 1TT2A 3CXCA 4P72A 1ENAA 1TIID 2X69A 1SN8A 2N3SA 2PZTA 1DOMA 2MFIA 2I0QA 1LO5D 1D8LA 3I4OA 3MA2B 2HQLA 2RHSB 2R6GA 5AFWA 3GTKH 1I94L 5KYIA 3TP8A 3ITPA 2XRSD 4Y7NB 5IT9E 1R4QB 3IL8A 2K5HA 1IW7C 1DOKA 1F9RA 2CH4A 1HTLD 3FRPB 3GV3A 5JJZA 2A1AA 1STNA 1F9SA 2ZM6Q 2HHHQ 2UUCQ 5LL6S 4LFBL 1X9NA 5A2QL 3A56A 4IJHA 3MHBA 4LF4Q 3UDXA 2JA5H 1E3PA 2LXKA 1S5DD 2SNSA 3K5OA 3KLRA 4A3CG 1XMQL 2WV6D 1LABA 2KCCA 4X3SA 4FF3A 2MHVA 3UE0A 1JE4A 2EYPA 1JJ2A 4KI0A 5CV5A 5FLMH 1ASYA 2ASBA 3CCLA 5M5YB 1EEID 1MIUA 1M8AA 5COYA 2HDLA 2RCFA 4HTHA 1N34Q 2F4IA 4AYBB 2SDFA 2B29A 1NSNS 1QVCA 2D0OA 1SROA 3PO2G 4C2MB 1IBKQ 2A6ED 3PQIA 3S16B 1AP0A 2BCOA 3GTOH 3CAMA 4GLXA 3CC4A 2HHHL 2UUCL 2CW0C 1V43A 3W3AA 1CA6A 5JJIA 3D6WA 1S40A 4LF4L 3S24A 2LKVA 1IKLA 1U4RA 5BN5A 2AWOA 3HKZB 4H7BA 3RLOA 4N9TA 1RCVD 5E1FA 2ID0A 3CCSA 3R3OA 5C5MA 5C0XJ 1KRTA 4K5XA 1J5EL 2F0VA 1BCPD 4KD4A 2NTSA 1XX8A
chains in the Genus database with same CATH topology
3FEWX 3I90A 3FMCA 3T53B 2L0CA 3KK7A 2A73B 1FYCA 4A3DB 3SXHA 3C2PA 3S2DB 4ZKCB 2HUGA 4ZYSA 2J0TD 2B2WC 5C6AA 5CV7A 1CHPD 2DN8A 2Q8RE 3UI2A 1GOZA 4CBVA 4XYQA 5C3XA 1UAPA 5EKIA 1EZ6A 3AMUA 1FGBD 3NPPA 1X32A 3MFGA 4RAUC 1EU4A 4I65A 5KYLA 2G9HD 2WB1B 3TBIB 1ML0D 2A6HD 2JEBI 5E4WC 1CHQD 2F03A 1STEA 4B08A 5K36H 2IJ0A 1QJOA 5ELDA 3SVMA 2K7VA 1O80A 2NYZD 1SYCA 3I4MB 2A5HA 1BR9A 1NAPA 2MUYA 3EROA 3HEJA 1RDPD 1SDFA 2C9OA 2R61A 1JOOA 5I9PA 3QWNA 4IALA 1QCBD 1UNSA 2LMCB 2Z8LA 4NMZA 2NN6I 5C4HA 1OXXK 1XTCD 4ILWA 4DXFA 4FVMA 2E76C 3A8IE 3T13A 3J7AF 2A74C 4DNRB 1GHJA 1CZWA 1CFMA 1BF4A 3OPOA 4RCOA 3AB9A 5KNBA 4IQZA 2EYHA 4KY5A 4WJWA 4CJ2C 1KAAA 4HCSA 5DEHA 3M4OB 1C4QA 2F0KA 2R93B 2K05A 4KJNA 1MGSA 1R9TB 5J22A 3RZDB 4XXEA 4IFDI 3S1MB 4FF1A 1CI3M 4F87A 1AZPA 1PTOF 4KD3A 2PQEA 3BVZA 2AWNA 2Z4IA 1HA5A 4K8JA 2B8GA 5M9OA 1HQRD 3Q23A 3VR6A 4MIUA 1LTID 5D14A 2B8FA 4ZRZA 5JVH3 4RFBA 1AW7A 3Q0AA 1LT4D 3S17B 1TS2A 2AQ3B 1DCZA 1NCVA 2XVSA 1IKMA 1PXUA 3MZ5A 3Q6SA 5M3MB 1CK1A 3HOWB 1LLRD 3W2DA 1PYWD 4WRDA 1WCMB 3D6CA 2MJ8A 4C3JB 1C48A 4TSSA 3NBIA 2V4DA 4LAAA 3ND9A 4I7ZC 1A3VA 2EY5A 3CQZB 3DEPA 3FVQA 3R8BA 4DNTB 1G8ZD 3ZYYX 1G6ZA 4V190 4Q0FA 1EIHA 3A54A 4B9WA 1JCKB 3SK4A 3OMGA 1SYGA 1PFBA 2RDFA 3WOEA 4FP5D 4BY1B 1SEBD 4FF4A 4LK1C 5K36G 2DNCA 1TWCB 5IGCA 3NQTA 3LWEA 1X3QA 5J1ZA 1ILPA 2NUCA 2NBFA 5KGUA 3DWPA 3RMHA 5I6WA 1STHA 1WVLA 3NE5B 1ZKOA 4IUQA 1H9KA 4XQJA 4G4KA 5CBEE 1HRJA 2EVBA 3EQLC 3NQIA 3BYTB 5I9OA 2K33A 1K8OA 1EY4A 1SE2A 4RHRA 1I6HB 2F0PA 4DK1A 1I4XA 1HFNA 3G7LA 5IIFA 2KCNA 1KLUD 3MFYA 2WKCA 3DEOA 1SSOA 1GJXA 4DU9A 1XYIA 2JP1A 3M4YA 2BA0A 3TMEA 1E2VA 4FNFA 5C4XB 2ZXPA 1HUMA 3DM1A 2XNAC 2JA8B 4OO1I 1BOSA 3SHLA 4KKTA 1I3QB 4KMUC 3GTGB 4TRDA 1DXMA 4M8AA 4Q5VA 2EJGC 2NN6H 5FLXL 2F0GA 4PQXA 1VCIA 2WP8J 1UUPA 1KDCA 1EY9A 1K8MA 3MXGA 5CV8A 2LS01 2SEBD 1JWSD 2JYOA 1WTWA 3QIAA 4X3KA 3IFTA 2JEAI 1BCPC 3CU7A 1SNCA 2CVRA 2PNRC 3HRZC 2YU9B 3BYYB 2WAQB 3SK8A 3KLSX 1JC7A 4DXGA 4RA8A 1PTOH 3OOCA 4QUFA 5IGBA 4PMBA 4ZKBB 2L9HA 1J8IA 2M2LA 3OIQA 1I4GA 3GTMB 4L6TB 1I4HA 3NTIA 1TY0A 2D9UA 2AUKA 1OXTA 2EYJA 4CHTB 2B2TA 1V1PA 1ET9A 3J80E 2HQEA 1GUWA 2KECA 3I4NB 2F0JA 2A6HC 2EE1A 2NWGA 2OXPA 1I50B 3VR4A 3VA5A 1ET6A 3FDTA 1TS3A 2F0HA 2K28A 1Z7TA 1MI2A 2L11A 3A7LA 2E74C 1RODA 1WTOA 1FNUA 3N52A 2KJXA 4QB4A 2NVQB 4X3TA 2BDNA 4KN7C 3QG1A 1PZID 2FFKB 4ZAIA 1EY5A 4NP5A 5JEAH 4DN4M 4PNYA 4RGOS 1Y1WB 4XT1B 1Q1EA 2IT1A 2JA7B 4BY7B 1DOLA 3I72A 3IFDA 1D1KA 2K6AA 5TSSA 1NR2A 3CRKC 3V96A 1H9SA 3K6OA 4U68A 3NHHA 3FPUB 3X3MA 5G3LF 1B9NA 3D4DA 3DWQA 3KBXA 2ZXRA 5KNCA 5D3IB 2VNUD 1SNOA 1D5ZC 1E0BA 3HOUB 4K8IA 1X3PA 4C1NI 1DZ1A 5C0XI 1XXGA 1EYDA 2NN6G 3GD7A 3IKJA 2XWBB 2H1EA 3HP3A 1B3AA 1HA6A 5DM73 4RH6A 4C3HB 2D2CC 2TMPA 1KDAA 1QG7A 4HAEA 5EPJA 2E2DC 4A3FB 4C3IG 1STYA 1D2BA 5A35A 5IT9L 5D3DA 5EBDA 2F0FA 5KNDA 2HCIA 2KHSA 4BBRB 2QILA 5JOBA 1HHVA 3MEHA 1WTVA 1BQQT 2FMCA 3KF8A 2WACA 1TKWB 1WTPA 1ZEQX 2IX0A 4BBSB 1WTQA 1GUSA 2JE6I 3C3LA 2B2YA 1A3UA 3NXWA 2NVXB 3S1RB 3P75A 1OXVA 1SJHD 1EQTA 3PO3B 5IGFA 3K5LA 1JOQA 1JWUD 1Q1BA 1EYCA 4KY6A 3HS0C 1Q12A 3MC0B 1O7LA 5JPNC 3EJIA 4G7ZC 2PYKA 1EYAA 1QNKA 2B63B 1A15A 4A3GB 5EQ0A 3OWFA 1EY7A 5CV6A 1ILQA 5CORA 3F2UA 3I8ZA 4R9WA 5IGEA 1CT1D 3M3YB 4FXKC 5BN3A 3GTLB 4KV6A 1G291 1PRTF 2B2UA 1VMPA 3I4LA 5C4ZA 1AFPA 4KTAA 1RJTA 1GUNA 1SAPA 5CV4A 5EKLA 2L1BA 4FXGC 1S5BD 3BDLA 3NWTA 5JEAG 3CHBD 3MAQA 5G3LD 3WOFA 1E2WA 2PO4A 2D62A 4ZQ3A 4H0LC 1TR5A 1RKNA 1V1PB 3PUZA 5KIXA 1GXDC 2K5WA 4GZYC 1Y8OB 4ID6A 3QOLA 5CBAE 2BE5D 1II3A 1F9PA 1PZJD 1EQVA 5ELFA 3A7AB 2EPBA 5NUCA 5K5PA 2G9DA 3H3VC 5EPLA 3MXUA 4KHVA 3VYUA 4EGVA 3AU7A 1T5XD 1EY6A 2QKIC 5M5XB 1SNMA 3I73A 2FINB 3NSWA 2RDHA 1L0YB 3S9WA 1EEFD 1IW7D 4JBWA 3U9OA 1LT3D 2PZUA 3PO2B 3FKIB 3GP7A 4H44C 5ISRA 2A69C 1I4QA 2EY2A 1EWCA 1HQMC 2FMMA 3L9AX 5FO7B 4DFAA 4CJ1B 1YNJD 2F0MA 3SK5A 3HZXA 1B50A 1LV9A 3E5SA 1H9SB 1JOKA 4IUPA 1EY0A 1DD2A 3DXJC 1VF7A 1KNAA 1EIGA 2MP1A 1KABA 2F0LA 4PMCA 1U9RA 1EU3A 2N88A 4J1MA 1CTMA 1EY8A 2GA4B 2DNEA 3WDNA 3LNNA 4YIJA 3D31A 5C3EB 3QO2A 1PDQA 1PLFA 1KTKA 2CW0D 4C1NK 2R92B 1F2MA 2QEJC 3TZDA 2B2VA 4K5VA 1PRTD 1JB3A 1ZYRD 3J81E 1O7YA 4RGTA 4TQUS 1A2UA 4HCEA 5LL6X 3DUZA 1DM0B 3RUZA 1TS4A 1Y8NB 3TDQA 2LY7A 1QB5D 2J4XA 1SE4A 1TVXA 1I4RA 3SDZA 1EFID 3VR5A 1O7ZA 1HCZA 2F0UA 5LHY1 3OHXC 1B9MA 2CQAA 2FJ2A 2F0OA 4RWSC 2FHTA 2IWHA 2K04A 5BN4A 2A68D 3OWEB 3D4RA 2WINB 1JQYD 1TU2B 4FF2A 4R8NA 2ICEC 4L8JA 3GTKB 1KNEA 2BDOA 2K03A 5I4DA 2F0QA 5J39A 4KKSA 4NW2A 1A2TA 1H9MA 1SYDA 3BVMA 3SEBA 5EKKA 3H94A 3G6JB 2JA5B 4XYOA 3KUPA 4WORA 1ZXTA 1NUCA 1FNVA 5KEEA 2EYLA 3URYA 1PTOD 1BXTA 2AQ1B 2NTTA 1G2SA 2M00A 1F2LA 3I3CA 1ENFA 3Q22A 5ELEA 1QE6A 1HTPA 2IPKD 3BG3A 2AUJD 5DAUA 4CKBA 1WTXA 1W6JA 5CYUA 3GTOB 4OGQC 1PFMA 2PW7A 1WD0A 3TZUA 3V05A 3GQBA 1MD2D 4MHEA 3BZDB 2A6EC 2M9VA 1LTRD 2EJFC 1SJED 2N55A 1RD9D 4B9XA 1S5CD 1B44D 3RLFA 3PUYA 4UAIA 5IODA 4KY7A 5HURA 2X6GA 4BWGB 3VYSA 4CKEA 2RKSA 1U4PA 3GTJB 4RGMA 4J8QA 3NBHA 2EOTA 4M1UB 1TQOA 3EFXD 1FR3A 1SBBB 4PMWA 4MN3A 5IOCA 2O4XA 2F0NA 1SMYD 4IFDH 2AQ2B 1RTNA 2EZVA 4ABNA 1SXTA 3PUXA 1ONLA 1LTBD 3E6ZX 4KN4C 2XRQD 2Y0SB 2LFNA 1DYQA 5T1GA 2I46A 2K5DA 2QDBA 3R2TA 3BDCA 1EZ8A 5E4XA 4ULLA 1JICA 1F2ZA 5M3FB 1V1OA 4K6DA 2BA1A 2JSOA 1BNZA 1S5FD 4DF7A 2B2WA 3PIO3 3PV0A 1BCPF 1LT5D 2E2JB 5M5WB 2XN9C 1RF2D 3EVQA 3R93A 1TWGB 1B53A 1SNDA 2DY8A 4WFN3 4ZUJA 5A2QE 4KK7A 3OIPA 1STGA 4QUCA 3VR3A 5EPKA 3CKIB 1M4VA 3P20A 3GO5A 2K01A 3KLSA 4BA2I 2F1MA 2F0IA 4HR7B 1HFGA 5IGGA 3J7YW 2BE5C 2IW3A 4K6LA 3D4WA 1YNND 1B1ZA 3J80L 2Z4HA 1A3TA 2Q8IB 3DMUA 1JWMD 4TKOB 3M85A 4ZK9B 4L63B 1D1IA 5CGKA 5C3WA 1JR0D 1AEXA 1KLGD 4EVOA 5FKAC 4NDXA 3H09A 2KEEA 2IX1A 1HXYD 1H9JA 3ONAB 4IZ8A 3NWSA 1OO9B 3GV6A 3TP5A 4OIJA 2VUMB 1S4ZA 3HOVB 4QCLA 2NB0A 5EBCA 2R3ZA 4R8IA 3MXNA 2O5JC 3L3OC 5CMDA 2K5QA 2EY6A 4CJ0B 1Q8IA 1YNJC 4A93B 2BOSA 5ELCA 3U9SA 4V0BA 1XWEA 1HUNA 3K5MA 4A3EB 2WKDA 2D5DA 1VDZA 1CQFA 3PUWA 4IN3A 3TN2A 3M7GA 5T1IA 3SK6A 1F9QA 3VR2A 4IFDG 4DAVA 3HOYB 2PCFB 3H6MA 2VXWA 1BDOA 4OO1H 1MSGA 3H91A 2ICIA 3K7AB 1PRTC 1O78A 2NVTB 1PFNA 3Q24A 2PMZB 3MXPA 3NTKA 1ZYRC 4EQNA 2SOBA 2B2TC 5JPMC 2MPMA 1AZQA 2L55A 4HEDA 1OXUA 1F77A 4DK0A 4HSPA 2E2IB 2PZWA 2F3VA 2ENBA 5F2DA 5JVG3 3P7JA 1LTGD 3HGBA 4S3SA 3V2TA 1SNQA 3C1FA 2A68C 4C3JG 1EL0A 4NKLA 4DA2A 2CHBD 1F2YA 1MSHA 2EYFA 1VF5C 4F7XA 1I6VC 4O42A 1EOTA 2L4NA 3IAYA 4XDXA 2JA6B 5C44B 4FO2A 4RCNA 1PRTB 1U4LA 2F0DA 1D6EC 1ESRA 1L0XB 2PW5A 2EDGA 4F88A 5FOBB 2YYZA 1STBA 2EJMA 3P1HA 1J9OA 1BO0A 1PZKD 2XIWA 1QILA 4XQQA 2L12A 3QJYA 4FXDA 4XTCS 2IL8A 2KVMA 1CA5A 3OMCA 1TWAB 1QOHA 4P2CB 1PTOC 1R4PB 4DGZA 3LX0A 4CKCA 5FO8B 1U4MA 2OT2A 1WTRA 4OL7A 4KHZA 1ESFA 3JAME 3I70A 1FNWA 4G7HC 1SNPA 1S5ED 4G57A 2C5CA 4OHJA 4XT3B 1Z47A 3PMFA 3SE0A 1V8QA 2HCCA 3X3NA 4A3KB 3TP6A 3J7AV 2E2HB 4C3IB 2OEOA 4RKLA 4HSVA 5CV9A 4A3IB 3M7NA 1W6KA 3ND8A 2O5IC 3BDOA 4IUNA 1I4PA 4JK1C 1PTOB 2F0WA 3QB3A 3MWYW 5EJWA 3I91A 4IURA 3KBGA 4OO1G 2RSNA 4Z9CB 3K57A 3A55A 3SR1A 2ZT9C 3A8KE 5E3FA 3JAML 2QF7A 3BS1A 5D65A 1FD7D 2R7ZB 1SYBA 5C0XH 3PUVA 1SMYC 2B2YC 1HPCA 4C56C 3C1EA 3VYTA 3R2IA 4HMIA 5I6YA 3K59A 2KUMA 3HOXB 2I07B 5EGTA 5DNFA 4IUTA 4ME5A 4O1NA 4IUUA 1SYEA 4FYDA 3HOZB 2RDGA 4A3JB 3DHQA 3GTPB 2X6LA 4IFDJ 1GUGA 1OXSC 2SNMA 3LWUA 5I2XA 1D5XC 1CZGA 5JAVA 4RGNA 2KQ3A 1E2ZA 1TY2A 3H0GB 2K32A 3S14B 2B2UC 1B2TA 1BUVT 2B39A 2KA7A 3NUCA 5HGTA 1IYUA 1LTSD 1PMRA 2EYOA 4HN7A 5KRUA 3OSOA 5CC4A 1ICWA 4F8MA 4PV1C 2DY7A 5C5LA 4QF4A 1NR4A 1T5EA 1Y8PB 5DM63 1TWHB 4E6IA 1SYFA 1JORA 2VB2X 1B4OA 2RQXA 1KDBA 1BBXC 3L7ZC 2F0TA 1IL8A 2IX3A 1LTTD 4DAPA 3J81L 4K5WA 1GHKA 1WD1A 4K2KA 1YNNC 4G7OC 4H13C 2RA4A 3K58A 1DJRD 1VMCA 4A3BB 1CQVA 1ENCA 4HMJA 5JEAJ 2EYMA 3EA6A 3ERQA 3NK9A 1Z6HA 5FLXE 4KKUA 1STAA 1EWHA 1LT6D 4ZUIA 1G91A 4XQNA 4EQPA 2MGSA 1C8CA 3RZOB 2HDMA 3S2HB 2QCPX 3C46A 1GUTA 1LACA 2Z1CA 3TSSA 2KOLA 4A3MB 2F0SA 1DONA 3PIP3 1A6XA 1UEAB 4QMGA 3T4AC 1LTAD 4ODGA 3MVVA 3DWAA 3T56B 1RHPA 1Q3LA 2RSOA 4BA1I 2TSSA 2K1BA 3E0JA 2F3WA 5FO9B 1QNUA 1CM9A 1D5MC 2OF1A 3K5NA 1AN8A 1TWFB 3NTHA 3VA7A 3GTQB 5C0XG 2XWJB 2A69D 3D3RA 1G2TA 2Q8TA 1SFOB 4QIWB 1Y69U 3O13A 3BVGA 4RHSA 4C3HG 4LMQD 2L5TA 2B2VC 4J6HA 1IYVA 3K0YA 2F0EA 5I2YA 2KEDA 4N9PA 2H4OA 3S1NB 2E75C 3S1QB 2J7ZA 3OW7A 3QOJA 3MTSA 4XIGS 1MBYA 4LJZC 4UDUC 2PPBC 4CGYB 4OIKA 1SE3A 2O2LD 3NP8A 4DAYA 3CRLC 1RTOA 1TS5A 4IUVA 4BS9A 5C4JB 3VYRA 1K83B 3RD4A 1QWYA 1GUOA 2JXMB 2XSCA 5ELBA 2NVYB 2WIIB 3D8GA 4ZLTF 4KJOA 4EQOA 3A8JE 4U673 1H9RA 3N6RA 5CR3A 1Q90A 2RBMA 1BCPB 4K2LA 1Y1VB 4X3UA 2VB3X 2EY1A 3FPPA 3T51B 4RKBA 5FK9C 3S15B 2RVLA 2EXZA 2ZXOA 3TP7A 1IHZA 3T16A 5IGDA 2NZ1D 3HG9A 4K14A 1TT2A 1ENAA 1TIID 2X69A 2PZTA 1DOMA 1LO5D 3MA2B 2R6GA 5AFWA 5KYIA 3TP8A 3ITPA 2XRSD 4Y7NB 5IT9E 1R4QB 5JJZA 3IL8A 1IW7C 1DOKA 1F9RA 3GV3A 1HTLD 3FRPB 1STNA 1F9SA 5LL6S 5A2QL 3A56A 3MHBA 1S5DD 2SNSA 3K5OA 3KLRA 2WV6D 1LABA 2KCCA 4X3SA 4FF3A 2MHVA 1JE4A 2EYPA 4KI0A 5CV5A 5M5YB 1EEID 1M8AA 5COYA 2HDLA 4HTHA 2F4IA 4AYBB 2SDFA 1NSNS 4C2MB 2A6ED 3S16B 1AP0A 2BCOA 2CW0C 1V43A 3W3AA 1CA6A 3D6WA 2LKVA 1IKLA 1U4RA 5BN5A 2AWOA 3HKZB 4H7BA 4N9TA 1RCVD 5E1FA 2ID0A 3R3OA 5C5MA 5C0XJ 4K5XA 2F0VA 1BCPD 4KD4A 2NTSA 1XX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMQ D;  1C8C A;  2B2V C;  5T1G A;  3I90 A;  1DOM A;  3FDT A;  1G2S A;  1WD1 A;  1EIH A;  3MWY W;  4O42 A;  1EOT A;  1F2L A;  2L4N A;  3I3C A;  5EJW A;  3TZD A;  5CMD A;  2B2V A;  1PFB A;  2K28 A;  4XDX A;  5AFW A;  2HCI A;  1MI2 A;  3I91 A;  2L11 A;  2RA4 A;  4IUR A;  1QE6 A;  2KED A;  4CJ2 C;  4CJ0 B;  1ROD A;  2RSN A;  4HCS A;  1WTO A;  5CBA E;  1U4L A;  3N52 A;  1WTX A;  1HHV A;  1O7Y A;  4ZKC B;  1WTV A;  1ESR A;  1F9P A;  1DOK A;  1F9R A;  1VMC A;  3GV3 A;  2HUG A;  3IL8 A;  5E4X A;  5JJZ A;  1JIC A;  2J7Z A;  5D65 A;  1B2T A;  1PFM A;  2K05 A;  2EPB A;  2B2W C;  1F9S A;  1WD0 A;  3MTS A;  1HUN A;  3LWE A;  4X3T A;  2BDN A;  1X3Q A;  1ILP A;  1BNZ A;  1WTP A;  1TVX A;  2Q8R E;  1MGS A;  3UI2 A;  2FFK B;  4OIK A;  4ZAI A;  2B2W A;  2R3Z A;  5EPL A;  1J9O A;  1O7Z A;  1WTQ A;  2B2Y C;  1RTO A;  2JYO A;  4DN4 M;  1BO0 A;  2XIW A;  4XT1 B;  5EKI A;  4MHE A;  2L12 A;  1AZP A;  1CA5 A;  1WTW A;  1WVL A;  2B2Y A;  3TN2 A;  1G91 A;  3R93 A;  4IUV A;  4X3K A;  1EQT A;  1HFN A;  2IL8 A;  5T1I A;  1B53 A;  1X32 A;  2FJ2 A;  2KVM A;  2KUM A;  2MGS A;  1DOL A;  2DY8 A;  2FIN B;  2N55 A;  4IUQ A;  4RAU C;  4RWS C;  4X3S A;  5DNF A;  4IUT A;  2FHT A;  3IFD A;  2HDM A;  1JE4 A;  2K04 A;  2CVR A;  4QUC A;  1F9Q A;  5CBE E;  1HRJ A;  4IUU A;  1ML0 D;  5EPK A;  1NR2 A;  4U68 A;  2KOL A;  5D14 A;  2X6L A;  4UAI A;  1U4M A;  3FPU B;  2VXW A;  5E4W C;  4RA8 A;  1MSG A;  1M8A A;  3H91 A;  1QNK A;  5COY A;  4QUF A;  2HDL A;  2K01 A;  1WTR A;  1DON A;  2X6G A;  1A15 A;  4ZKB B;  1PFN A;  3KBX A;  1HFG A;  5EQ0 A;  2SDF A;  2L9H A;  1J8I A;  2M2L A;  4ZLT F;  1ILQ A;  1KNE A;  1U4P A;  3F2U A;  5COR A;  3SVM A;  1NCV A;  3I8Z A;  1E0B A;  4R9W A;  1RHP A;  1O80 A;  2K03 A;  1Q3L A;  2NYZ D;  1AP0 A;  2RSO A;  1IKM A;  2EOT A;  2B2U C;  2FMM A;  3G7L A;  2B2T C;  1X3P A;  1NAP A;  2MPM A;  4CJ1 B;  1AZQ A;  4ZK9 B;  2K1B A;  1DZ1 A;  1SDF A;  3Q6S A;  1B50 A;  2D9U A;  4NW2 A;  4HED A;  4XT3 B;  1LV9 A;  2B2U A;  1CM9 A;  1VMP A;  2B2T A;  1CA6 A;  3DEO A;  1SSO A;  3D6W A;  4IUP A;  4X3U A;  4R8I A;  2HCC A;  3P7J A;  4MN3 A;  1IKL A;  1KNA A;  1U4R A;  1XYI A;  1ICW A;  1GUW A;  2JP1 A;  2H1E A;  2KEC A;  2MJ8 A;  3HP3 A;  1B3A A;  2DY7 A;  1RJT A;  1EIG A;  1SAP A;  2KEE A;  2MP1 A;  1HA6 A;  2L1B A;  3ONA B;  2RVL A;  1NR4 A;  1RTN A;  2N88 A;  3GV6 A;  1B4O A;  1G2T A;  1HUM A;  4HSV A;  4OIJ A;  2Q8T A;  2NZ1 D;  1S4Z A;  3DM1 A;  3DEP A;  3KUP A;  1QG7 A;  1ZXT A;  2EE1 A;  4HAE A;  5EPJ A;  1BBX C;  1EL0 A;  2NWG A;  1IL8 A;  3QO2 A;  2X69 A;  1PDQ A;  1BF4 A;  1G6Z A;  1PLF A;  1XX8 A;  1MSH A; 
#chains in the Genus database with same CATH topology
 4GKK L;  4JI5 Q;  3FEW X;  3I90 A;  1N34 L;  5IP7 H;  3FMC A;  3T53 B;  2L0C A;  5C3E G;  3KK7 A;  3RNU A;  4HJ9 A;  1IBK L;  4UP7 A;  3GTJ H;  2R92 G;  2A73 B;  1FYC A;  4ZCK A;  4AYB E;  4A3D B;  3SXH A;  3C2P A;  4X65 Q;  3S2D B;  5L37 A;  4ZKC B;  2RF4 A;  2HUG A;  4ZYS A;  2J0T D;  2B2W C;  5C6A A;  5CV7 A;  1CHP D;  2DN8 A;  2Q8R E;  3UI2 A;  1GOZ A;  4CBV A;  2YV5 A;  4XYQ A;  1CKN A;  4B3M Q;  5C3X A;  1UAP A;  5EKI A;  3TS0 A;  1EZ6 A;  3AMU A;  1FGB D;  3HKZ E;  3NPP A;  1X32 A;  3MFG A;  2VS1 A;  4RAU C;  1EU4 A;  4I65 A;  5KYL A;  2G9H D;  2WB1 B;  3KDF A;  4UP8 A;  4NXN Q;  1Q46 A;  3TBI B;  1KAW A;  1ML0 D;  4JI5 L;  2A6H D;  2JEB I;  5E4W C;  1CHQ D;  2F03 A;  1STE A;  4B08 A;  5K36 H;  4DAY B;  2IJ0 A;  1EQQ A;  1QJO A;  5ELD A;  1PV4 A;  3SVM A;  2F52 A;  2K7V A;  5C4J H;  2IY5 B;  1SMX A;  1O80 A;  2NYZ D;  1SYC A;  3OTO L;  3I4M B;  4X6A H;  2A5H A;  1BR9 A;  1NAP A;  2MUY A;  2Z6B A;  3ERO A;  3HEJ A;  5M3F H;  1RDP D;  1SDF A;  5IYB H;  2C9O A;  4KHP Q;  4AQY Q;  2R61 A;  1JOO A;  5I9P A;  1K28 A;  3QWN A;  4IAL A;  4B3M L;  3MEF A;  1QCB D;  1UNS A;  2LMC B;  2Z8L A;  1J6Q A;  2E2J H;  5M5W H;  4NMZ A;  2IHF A;  4K0K Q;  2NN6 I;  5C4H A;  4NXN L;  1OXX K;  1TWG H;  1XTC D;  4ILW A;  4DXF A;  4FVM A;  2E76 C;  4GOP C;  3A8I E;  3T13 A;  3J7A F;  2A74 C;  4DNR B;  2JA5 G;  1GHJ A;  1CZW A;  1CFM A;  1HR0 Q;  1B70 B;  4RMF A;  1X55 A;  2WB1 E;  3OPO A;  1BF4 A;  4RCO A;  3AB9 A;  5KNB A;  4IQZ A;  1E1O A;  2EYH A;  3CPF A;  4KY5 A;  3S15 H;  4WJW A;  3RN2 A;  4JCV E;  5FLM G;  4CJ2 C;  2N8N A;  4P74 A;  4N8F A;  1KAA A;  4HCS A;  5DEH A;  3M4O B;  1C4Q A;  2F0K A;  4KHP L;  4AQY L;  2R93 B;  2K05 A;  4KJN A;  1MGS A;  2ZTD A;  1R9T B;  2PI2 A;  1AE2 A;  4NPS A;  5J22 A;  3RZD B;  4K0K L;  4XXE A;  1QVG A;  1PH2 A;  4IFD I;  3S1M B;  3BJU A;  4FF1 A;  1CI3 M;  4F87 A;  1AZP A;  1PTO F;  4KD3 A;  5ELN A;  2PQE A;  1M90 C;  5GRO A;  3BVZ A;  2AWN A;  4JOI A;  2Z4I A;  1HA5 A;  4K8J A;  2B8G A;  5M9O A;  1HR0 L;  3HOV H;  1HQR D;  2KHJ A;  4JPB W;  3Q23 A;  3VR6 A;  4MIU A;  1LTI D;  5D14 A;  2B8F A;  4ZRZ A;  5JVH 3;  4GOP B;  4PG3 A;  3JC6 6;  4RFB A;  1AW7 A;  1A62 A;  2R7D A;  3Q0A A;  1JMC A;  1LUZ A;  1LT4 D;  2CFM A;  3S17 B;  1TS2 A;  2AQ3 B;  1DCZ A;  1Q8K A;  1S3O A;  1XPO A;  1NCV A;  2XVS A;  4A93 H;  5IP7 G;  3CMA A;  1IKM A;  2JA9 A;  1PXU A;  3MZ5 A;  2HD3 A;  3Q6S A;  4DPG A;  5M3M B;  1GO3 E;  1CK1 A;  3HOW B;  1LLR D;  1X54 A;  4A3E H;  3W2D A;  1PYW D;  4WRD A;  1WCM B;  1VQ6 A;  3D6C A;  2YTY A;  2MJ8 A;  4C3J B;  1C48 A;  4TSS A;  2N78 A;  3W5O A;  3NBI A;  4HJ5 A;  4DUZ Q;  2V4D A;  4LAA A;  3ND9 A;  4I7Z C;  2LSS A;  1A3V A;  2EY5 A;  3CQZ B;  3DEP A;  3FVQ A;  1VQ9 A;  3R8B A;  4JI7 Q;  4DNT B;  4JI8 Q;  1G8Z D;  3HOY H;  3ZYY X;  1G6Z A;  4V19 0;  3OW2 A;  2UUB Q;  3J81 j;  4Q0F A;  3K7A H;  1EIH A;  3A54 A;  4B9W A;  1JCK B;  3SK4 A;  2Y0S G;  3OMG A;  1SYG A;  2NVT H;  1PFB A;  4GN5 A;  2RDF A;  1I5F A;  2KHI A;  3WOE A;  4FP5 D;  1UEB A;  4BY1 B;  1BBW A;  1N32 L;  1SEB D;  4FF4 A;  4LK1 C;  2CQO A;  5K36 G;  2DNC A;  1XMO Q;  1TWC B;  5IGC A;  3NQT A;  3LWE A;  1X3Q A;  5J1Z A;  2E2I H;  1ILP A;  2NUC A;  2NBF A;  1K0R A;  4GN4 B;  5KGU A;  3DWP A;  4UP9 A;  3RMH A;  1VQE A;  5I6W A;  5M3F G;  5IYB G;  1STH A;  1VQO A;  4DUZ L;  1WVL A;  1HNW Q;  4DUY Q;  1NJI C;  3F2B A;  1K9M C;  4GKJ Q;  3NE5 B;  1ZKO A;  2RCN A;  4A3L H;  4IUQ A;  1H9K A;  2K14 A;  4XQJ A;  4JI7 L;  4G4K A;  4JI8 L;  5CBE E;  1HRJ A;  2EVB A;  3CME A;  3EQL C;  3NQI A;  2UUB L;  1N8R C;  3BYT B;  1WOC A;  2HIX A;  2K4K A;  1VQN A;  5I9O A;  2K33 A;  1K8O A;  1EY4 A;  1SE2 A;  1CKN B;  4JI4 Q;  4RHR A;  2JA6 H;  5C44 H;  1I6H B;  4JBK A;  2F0P A;  3UDG A;  4DK1 A;  1I4X A;  1UE5 A;  2MO1 A;  3G4S A;  1XMO L;  1PA6 A;  1HFN A;  3G7L A;  3KDF B;  5IIF A;  2KCN A;  3CPW A;  1HJP A;  1N33 Q;  1KLU D;  3MFY A;  4GNX C;  2WKC A;  1PH9 A;  3DEO A;  1SSO A;  4L5S A;  3KF6 B;  1GJX A;  4DU9 A;  4LF5 Q;  3LGJ A;  1XYI A;  3PSI A;  1HNW L;  4DUY L;  2JP1 A;  3M4Y A;  2BA0 A;  3TME A;  1E2V A;  1D7Q A;  2K52 A;  4GKJ L;  4FNF A;  5C4X B;  4FDB A;  1VQA A;  2ZXP A;  1LYL A;  1HUM A;  3DM1 A;  2XNA C;  1VQD A;  2JA8 B;  1CSQ A;  4DK3 C;  3J80 c;  4OO1 I;  1BOS A;  3SHL A;  5FJ8 H;  4KKT A;  5LMN Q;  4JBM A;  1I3Q B;  4R4T A;  2VUM G;  4A76 A;  1SR3 A;  4KMU C;  2JK8 A;  4JI4 L;  3HOV G;  3GTG B;  4TRD A;  1DXM A;  1UE7 A;  4M8A A;  4Q5V A;  2EJG C;  2MNA A;  2CCZ A;  1JJC B;  2NN6 H;  2YTV A;  5FLX L;  2F0G A;  4PQX A;  1VCI A;  4B3T Q;  2WP8 J;  1UUP A;  1KDC A;  1EY9 A;  1N33 L;  2DJG C;  1K8M A;  1NE3 A;  4CDF C;  3MXG A;  3U58 A;  1H95 A;  5CV8 A;  2LS0 1;  4LF5 L;  1W2B A;  4A93 G;  1VQP A;  2SEB D;  4LWC A;  1JWS D;  4A3K H;  2JYO A;  4Y52 H;  4DK6 C;  1WTW A;  3JAM i;  2E2H H;  3ULP A;  1KQS A;  4LUZ A;  4C3I H;  3QIA A;  4A3E G;  3KLW A;  4X3K A;  3G48 A;  1U5K A;  3IFT A;  2JEA I;  1BCP C;  3CU7 A;  4A3I H;  1SNC A;  2CVR A;  1K3R A;  5LMN L;  2PNR C;  3HRZ C;  2YU9 B;  3BYY B;  1CSP A;  2WAQ B;  3SK8 A;  3KLS X;  1JC7 A;  2KCM A;  4DXG A;  4RA8 A;  1PTO H;  3OOC A;  4QUF A;  5IGB A;  4PMB A;  4P71 A;  5IYD H;  4ZKB B;  2L9H A;  1J8I A;  3HOY G;  4YCU A;  2M2L A;  1YZ6 A;  1Q7Y C;  4JI3 Q;  1HZB A;  4B3T L;  2XTI A;  4KLK A;  1NBW A;  2E5L Q;  3OIQ A;  1IL2 A;  1I4G A;  3GTM B;  4L6T B;  1I4H A;  1HR0 W;  3NTI A;  1TY0 A;  2R7Z H;  5GAG C;  4LNQ A;  2D9U A;  2AUK A;  1OXT A;  2D0P A;  2EYJ A;  4JI0 Q;  4CHT B;  2B2T A;  1V1P A;  1ET9 A;  3CCQ A;  4JI2 Q;  3J80 E;  4CDC C;  2Z6K C;  2HQE A;  1GUW A;  2KEC A;  4DAM A;  3CCJ A;  4OON A;  1TXY A;  3HOX H;  4YY3 Q;  3I4N B;  1AE3 A;  2F0J A;  2A6H C;  3BU2 A;  2EE1 A;  2NWG A;  3HOZ H;  2OXP A;  1I50 B;  3VR4 A;  4A3J H;  3VA5 A;  3GTP H;  4YWL A;  1ET6 A;  4DV4 L;  4A3L G;  3FDT A;  1TS3 A;  4WJ3 M;  2WAQ E;  1Q82 C;  2F0H A;  4JI3 L;  2K28 A;  1Z7T A;  1MI2 A;  4DV3 Q;  2L11 A;  3A7L A;  2E74 C;  2PI2 E;  2E5L L;  1XPU A;  1ROD A;  3W1B A;  1WTO A;  1FNU A;  3H0G H;  3N52 A;  3S14 H;  4OWW B;  2K75 A;  2KJX A;  4QB4 A;  5IY0 A;  4JI0 L;  2NVQ B;  2JA6 G;  5C44 G;  1W3S A;  4X3T A;  2BDN A;  1YHB A;  4JI2 L;  4KN7 C;  3QG1 A;  1NY4 A;  1PZI D;  4A75 A;  2FFK B;  4ZAI A;  1EY5 A;  4NP5 A;  5JEA H;  4DN4 M;  4PNY A;  4RGO S;  1Y1W B;  4XT1 B;  1Q81 C;  1Q1E A;  2CWP A;  2IT1 A;  2JA7 B;  4YY3 L;  5AJ3 L;  3I55 A;  1TWH H;  4AH6 A;  4BY7 B;  1DOL A;  2PQA A;  3I72 A;  3IFD A;  1D1K A;  2K6A A;  5TSS A;  1NR2 A;  3CRK C;  3V96 A;  1H9S A;  3RLN A;  3K6O A;  4U68 A;  1N36 Q;  1NNX A;  3NHH A;  4L5R C;  3FPU B;  1QVF A;  1KIX A;  3UE1 A;  3X3M A;  1K3B C;  5G3L F;  1B9N A;  3D4D A;  1JB7 A;  3DWQ A;  4DV3 L;  3KBX A;  2ZXR A;  5KNC A;  2MO0 A;  5D3I B;  2VNU D;  1K8G A;  1SNO A;  4DR6 Q;  5FJ8 G;  1D5Z C;  2P5Z X;  1E0B A;  3HOU B;  4DV5 L;  4K8I A;  3K0X A;  3NEM A;  4A3B H;  1X3P A;  4C1N I;  1DZ1 A;  5C0X I;  1XXG A;  1EYD A;  2NN6 G;  1J5E Q;  3GD7 A;  3IKJ A;  2L15 A;  4CDE C;  2XWB B;  2KBN A;  3DLL A;  4GKK Q;  2H1E A;  4DV2 Q;  3HP3 A;  1B3A A;  1HA6 A;  1VQM A;  5DM7 3;  4RH6 A;  4C3H B;  4A3K G;  2D2C C;  3RZO H;  3S2H H;  2TMP A;  3M4Q A;  1KDA A;  1QG7 A;  1UE1 A;  4HAE A;  5EPJ A;  1N36 L;  2E2D C;  5JJL A;  4A3F B;  4B3R L;  1K73 C;  4UPA A;  1STY A;  4C3I G;  4A3M H;  1D2B A;  5A35 A;  4LF6 Q;  1E24 A;  4J15 A;  5IT9 L;  5D3D A;  5EBD A;  2F0F A;  4A3I G;  5KND A;  4DR6 L;  1FGU A;  2XGT A;  1KC8 C;  1LM0 A;  2HCI A;  1WFQ A;  2KHS A;  4R4I A;  4BBR B;  1VQ4 A;  2QIL A;  5JOB A;  4LF7 Q;  3MEH A;  1HHV A;  2BH8 A;  1WTV A;  5IYD G;  1BQQ T;  3STB C;  2FMC A;  1EIF A;  3KF8 A;  2WAC A;  1L2F A;  1TKW B;  1ZEQ X;  3PIO A;  1WTP A;  2IX0 A;  4BBS B;  1GM5 A;  4JYA Q;  4DV2 L;  1WTQ A;  1GUS A;  1TWF H;  5IE8 A;  2R7Z G;  2JE6 I;  3C3L A;  3GTQ H;  2B2Y A;  1A3U A;  3NXW A;  2NVX B;  3S1R B;  3P75 A;  1OXV A;  1CKO A;  1EQT A;  1SJH D;  2Q2H A;  3PO3 B;  5IGF A;  3K5L A;  1YI2 A;  1SFO H;  2OTL A;  1JOQ A;  1JWU D;  1Q1B A;  1EYC A;  4KY6 A;  3OTO Q;  3BZC A;  3HS0 C;  1Q12 A;  3MC0 B;  4LF6 L;  1O7L A;  5JPN C;  3EJI A;  4G7Z C;  2EQS A;  3HOX G;  2PYK A;  3JAM c;  1EYA A;  1QNK A;  5GAD C;  2B63 B;  1A15 A;  2H5X A;  3HOZ G;  4A3G B;  5EQ0 A;  1QUQ A;  5ELO A;  1BVS A;  4JI1 L;  3OWF A;  4A3J G;  1EY7 A;  4GN3 B;  1ILQ A;  3F2U A;  5COR A;  5CV6 A;  4LF7 L;  4EX5 A;  3I8Z A;  4R9W A;  5IGE A;  3PF5 A;  1CT1 D;  3M3Y B;  4FXK C;  5BN3 A;  3GTL B;  3S1N H;  3S1Q H;  2AHO B;  4KV6 A;  1O7I A;  1G29 1;  3E0E A;  1PRT F;  2B2U A;  5LMN W;  1VMP A;  1X3E A;  1YJW A;  4JYA L;  3I4L A;  2OWO A;  3H0G G;  5C4Z A;  1AFP A;  1G6P A;  1Z9F A;  1VQH A;  4KTA A;  1RJT A;  1GUN A;  1SAP A;  5CV4 A;  5EKL A;  2L1B A;  4FXG C;  1S5B D;  3BDL A;  4LFA Q;  3NWT A;  1PH4 A;  1KRS A;  5JEA G;  3KFU A;  1SE8 A;  3CHB D;  3MAQ A;  5G3L D;  1V1Q A;  3WWV A;  1K83 H;  3WOF A;  1E2W A;  4JW0 A;  2PO4 A;  2VW9 A;  2D62 A;  4ZQ3 A;  4H0L C;  1TR5 A;  1RKN A;  1V1P B;  3PUZ A;  5KIX A;  1GXD C;  2K5W A;  2OCE A;  4GZY C;  1N9W A;  2V1C C;  2NVY H;  1Y8O B;  1L1O A;  4ID6 A;  3U4V A;  3QOL A;  5CBA E;  2GN5 A;  2BE5 D;  1II3 A;  1F9P A;  1PZJ D;  1EQV A;  5ELF A;  3A7A B;  2EPB A;  3L2P A;  1MHW C;  4PZ6 A;  3A74 A;  5NUC A;  5K5P A;  1RIP A;  1Y1V H;  2G9D A;  3H3V C;  1HH2 P;  5EPL A;  2FXQ A;  4DV1 Q;  3MXU A;  4A3B G;  3QR8 A;  4KHV A;  3VYU A;  4LFA L;  4EGV A;  3AU7 A;  3J81 c;  1T5X D;  1EY6 A;  2QKI C;  5M5X B;  1SNM A;  1HNZ Q;  3I73 A;  2FIN B;  3NSW A;  3TQY A;  2RDH A;  1L0Y B;  4OXP A;  3ZJY C;  3S9W A;  5J3B A;  1EEF D;  1IW7 D;  4JBW A;  3U9O A;  1LT3 D;  4JV5 Q;  2PZU A;  3PO2 B;  3FKI B;  3GP7 A;  4H44 C;  5ISR A;  4P73 A;  5BR8 Q;  2A69 C;  3EN2 A;  1I4Q A;  5GAE C;  4A3M G;  2EY2 A;  1EWC A;  1HQM C;  4Y7N H;  3F2C A;  2FMM A;  3L9A X;  5FO7 B;  4DFA A;  2PQA B;  5DLQ E;  4CJ1 B;  1YNJ D;  4GLV B;  1HZ9 A;  2F0M A;  3SK5 A;  3HZX A;  1B50 A;  1LV9 A;  3E5S A;  1PH6 A;  4DV1 L;  3G71 A;  1H9S B;  1JOK A;  4IUP A;  1EY0 A;  1GD7 A;  1DD2 A;  3DXJ C;  1VF7 A;  1KNA A;  3H3V I;  1EIG A;  2MP1 A;  1HNZ L;  1KAB A;  2EXD A;  2F0L A;  4PMC A;  1KL9 A;  1U9R A;  1VQJ A;  1EU3 A;  2N88 A;  4J1M A;  1CTM A;  1EY8 A;  2GA4 B;  3M4P A;  2DNE A;  3NEN A;  3WDN A;  1N32 Q;  3LNN A;  4YIJ A;  3D31 A;  5C3E B;  3QO2 A;  4JV5 L;  1PDQ A;  4TVA B;  1PLF A;  3PCO B;  1KTK A;  5M5Y H;  2CW0 D;  4C1N K;  2R92 B;  1F2M A;  1U0L A;  5BR8 L;  2QEJ C;  3TZD A;  2B2V A;  5JJK A;  4K5V A;  1PRT D;  1JB3 A;  4C2M H;  3S16 H;  1ZYR D;  3J81 E;  1EOV A;  4HIM A;  1O7Y A;  4GS3 A;  1A2U A;  4RGT A;  4TQU S;  4HCE A;  5LL6 X;  3DUZ A;  1DM0 B;  3RUZ A;  1TS4 A;  1Y8N B;  3TDQ A;  2LY7 A;  2UU9 Q;  1P16 A;  1QB5 D;  1YVC A;  1G51 A;  2J4X A;  1SE4 A;  2A19 A;  4QL5 A;  1TVX A;  1K8A C;  1I4R A;  3SDZ A;  1EFI D;  3VR5 A;  1O7Z A;  1HCZ A;  2F0U A;  5LHY 1;  1XNQ Q;  4DV0 L;  3OHX C;  1B9M A;  1KXL A;  4YWK A;  2CQA A;  2FJ2 A;  2F0O A;  4RWS C;  2Q2I A;  2FHT A;  2IWH A;  2K04 A;  5BN4 A;  2A68 D;  1YIT A;  3OWE B;  3D4R A;  1HZC A;  2WIN B;  4X64 Q;  1JQY D;  1TU2 B;  3KF8 B;  4FF2 A;  3ER0 A;  3TS2 A;  1K0S A;  4R8N A;  2ICE C;  1BBU A;  4L8J A;  3GTK B;  1KNE A;  2VQE L;  2BDO A;  4ME3 A;  2K03 A;  4A3D H;  1VQ7 A;  1VQ5 A;  5I4D A;  3S2D H;  2F0Q A;  2UU9 L;  5J39 A;  3F8T A;  4KKS A;  4NW2 A;  3K8A A;  1SLJ A;  3T1Y L;  1A2T A;  1H9M A;  1XNQ L;  1SYD A;  2QW7 A;  2RHQ B;  5IP9 H;  2JJQ A;  3BVM A;  3SEB A;  4DR2 Q;  5EKK A;  3H94 A;  3G6J B;  2JA5 B;  4A4I A;  4XYO A;  1QUQ B;  1Y1V G;  3GTL H;  4BXX H;  3KUP A;  4WOR A;  1ZXT A;  2K5N A;  1NUC A;  1FNV A;  4X64 L;  2AMC B;  1PVO A;  1A63 A;  5KEE A;  4DV7 L;  2EYL A;  1PTO D;  3URY A;  1BXT A;  2AQ1 B;  2NTT A;  1MJE A;  2VQF L;  1G2S A;  2M00 A;  1F2L A;  3I3C A;  1ENF A;  3AEV A;  3Q22 A;  5ELE A;  1QE6 A;  1C9O A;  1HTP A;  2IPK D;  3BG3 A;  2AUJ D;  5DAU A;  4CKB A;  5IYC H;  1WTX A;  3I4M H;  3T1H Q;  2CKZ B;  1W6J A;  5CYU A;  3GTO B;  4OGQ C;  1PFM A;  4MTK A;  2PW7 A;  3E9I A;  1WD0 A;  3TZU A;  3V05 A;  4RG1 A;  4DR2 L;  3GQB A;  1PH8 A;  3CP0 A;  1MD2 D;  4MHE A;  3BZD B;  4JOI C;  3K7U C;  2A6E C;  2M9V A;  3CD6 A;  1LTR D;  2EJF C;  1IBM Q;  1L0W A;  1SJE D;  2N55 A;  1RD9 D;  4B9X A;  1S5C D;  3BZK A;  4DR7 Q;  1YIJ A;  1B44 D;  2DUD A;  3RLF A;  4JI6 Q;  3PUY A;  2OTJ A;  3F1Z A;  1ASZ A;  4UAI A;  3E3X A;  4PZ7 A;  5IOD A;  4KY7 A;  5HUR A;  2X6G A;  4BWG B;  3VYS A;  1SRU A;  4CKE A;  2RKS A;  5M5X H;  4HJ8 A;  2AKW B;  1U4P A;  3GTJ B;  1X6O A;  3T1H L;  3M4O H;  1JE5 A;  4RGM A;  4J8Q A;  3NBH A;  2EOT A;  3HKS A;  4AYB G;  4M1U B;  4YWM A;  2ZJR A;  2R93 H;  1PHJ A;  1TQO A;  4POG A;  3EFX D;  1VQG A;  1FR3 A;  4R4C A;  1HNX Q;  3FKI H;  5E7N A;  1R9T H;  3CCE A;  1SBB B;  4PMW A;  4MN3 A;  3RZD H;  4DV4 Q;  5IOC A;  3S1M H;  1WJJ A;  2O4X A;  2F0N A;  1IBM L;  1SMY D;  4IFD H;  2AQ2 B;  1RTN A;  2EZV A;  4ABN A;  4DR7 L;  3PGZ A;  1SXT A;  3PUX A;  1S72 A;  1ONL A;  3HKZ G;  1LTB D;  3E6Z X;  4KN4 C;  4JI6 L;  1PYS B;  2XRQ D;  2Y0S B;  3RN5 A;  2LFN A;  1DYQ A;  3Q8D A;  4YCW A;  5T1G A;  3H15 A;  2I46 A;  2K5D A;  2QDB A;  4PZ8 A;  3S17 H;  3H3V H;  4L5T A;  4DR5 Q;  2K50 A;  3R2T A;  3BDC A;  2HIV A;  1EYG A;  5AJ3 Q;  1EZ8 A;  5E4X A;  4ULL A;  1X3F A;  1JIC A;  5M3M H;  1F2Z A;  5M3F B;  1QZH A;  3RR5 A;  1HNX L;  1V1O A;  3HOW H;  4K6D A;  5GAH C;  2BA1 A;  2JSO A;  1BNZ A;  1S5F D;  1WCM H;  4A3D G;  4DF7 A;  2B2W A;  4QQB X;  3PIO 3;  3PV0 A;  3TRZ A;  4C3J H;  1BCP F;  1LT5 D;  2E2J B;  5M5W B;  2XN9 C;  4IOA A;  1RF2 D;  1VQB A;  3EVQ A;  3R93 A;  4HJ7 A;  4H02 A;  1TWG B;  1B53 A;  1SND A;  5IP9 G;  1A8V A;  1PYB A;  2DY8 A;  4ZUJ A;  4WFN 3;  3CQZ H;  5A2Q E;  1XTD A;  3OIP A;  1STG A;  4KK7 A;  4NXM Q;  4DV5 Q;  4QUC A;  3VR3 A;  5EPK A;  3CKI B;  1M4V A;  3P20 A;  3PIP A;  2WB1 G;  3GO5 A;  2Y0S E;  2K01 A;  3KLS A;  4BXX G;  4BA2 I;  2F1M A;  4DR5 L;  2I5L X;  2F0I A;  4HR7 B;  1HFG A;  5IGG A;  3J7Y W;  1IYJ B;  4I7A A;  2BE5 C;  2IW3 A;  4K6L A;  4BY1 H;  3PF4 A;  3D4W A;  1YNN D;  1B1Z A;  3J80 L;  5IWA Q;  2Z4H A;  1A3T A;  2G5D A;  2Q8I B;  3DMU A;  1JWM D;  4TKO B;  3M85 A;  1VQ8 A;  1M1K C;  4ZK9 B;  4L63 B;  1TWC H;  1D1I A;  1X65 A;  5CGK A;  5C3W A;  1JR0 D;  3SGI A;  1AEX A;  1KLG D;  1FL0 A;  4B3R Q;  4EVO A;  3I4M G;  3AYH B;  1VQF A;  5FKA C;  2EIF A;  5IYC G;  4NDX A;  3H09 A;  1MKH A;  2KEE A;  2IX1 A;  1HXY D;  2B3G A;  1H9J A;  3ONA B;  4IZ8 A;  3NWS A;  3EBE A;  1OO9 B;  3GV6 A;  3TP5 A;  4NXM L;  4OIJ A;  2VUM B;  1S4Z A;  3HOV B;  3W1G A;  4QCL A;  2NB0 A;  3CCV A;  4GOP A;  3U50 C;  2Z9H A;  1VQC A;  5EBC A;  2R3Z A;  4R8I A;  2ZTC A;  3ULL A;  3MXN A;  3UDI A;  4HIK A;  2O5J C;  3L3O C;  4QJF A;  1JJG A;  4B3S L;  5CMD A;  1I6H H;  3EIV A;  2K5Q A;  2EY6 A;  5IWA L;  4CJ0 B;  1Q8I A;  1YNJ C;  2DGY A;  4A93 B;  2CH4 W;  2BOS A;  5ELC A;  3U9S A;  4V0B A;  1XWE A;  1HUN A;  1PH3 A;  3K5M A;  4A3E B;  2WKD A;  1E1T A;  2D5D A;  3K81 C;  1VDZ A;  4EQ5 A;  1CQF A;  2C35 B;  3PUW A;  2R93 G;  4IN3 A;  3TN2 A;  4JG2 A;  1VS0 A;  3M7G A;  3FKI G;  5C4X H;  5T1I A;  4JI1 Q;  1WYD A;  2HT1 A;  3SK6 A;  2ZM6 L;  2JA8 H;  1F9Q A;  3VR2 A;  4N8X 1;  1UWV A;  4IFD G;  4DAV A;  4JVZ A;  3CCR A;  3HOY B;  2PCF B;  3H6M A;  4IPG A;  1I3Q H;  2VXW A;  1BDO A;  4OO1 H;  1MSG A;  3H91 A;  5HY6 A;  2ICI A;  3K7A B;  1PRT C;  4HJA A;  3GTG H;  3TRE A;  1O78 A;  1PH5 A;  2NVT B;  1PFN A;  3Q24 A;  2PMZ B;  3MXP A;  3FHW A;  3NTK A;  1ZYR C;  4EQN A;  3J7Z C;  1NTG A;  3VDY A;  4IPD A;  2JN4 A;  2SOB A;  4IJL A;  2B2T C;  5JPM C;  2MPM A;  1AZQ A;  3FP9 A;  2L55 A;  3ERS X;  4HED A;  1CUK A;  1OXU A;  1F77 A;  4DK0 A;  2A8V A;  4HSP A;  2E2I B;  2PZW A;  2F3V A;  2ENB A;  5F2D A;  5JVG 3;  1XJV A;  3P7J A;  1LTG D;  3HGB A;  4GLA C;  3DM3 A;  3KYH C;  4S3S A;  3V2T A;  5M3M G;  3HOW G;  1SNQ A;  4HIO A;  3C1F A;  3I2Z A;  2QEX A;  1WCM G;  3KJP A;  4R4Q A;  1EQR A;  2A68 C;  4WJ4 A;  4C3J G;  3NBH B;  5GQO A;  4DKA C;  1VQI A;  1EL0 A;  1VQK A;  4NKL A;  2YU9 H;  4DA2 A;  2CHB D;  1F2Y A;  1MSH A;  2EYF A;  1GVP A;  1VF5 C;  4IPC A;  4F7X A;  1I6V C;  2ALY B;  4O42 A;  1EOT A;  2L4N A;  5H1S E;  1V9P A;  3IAY A;  4XDX A;  2R7F A;  5EAY A;  4OX9 Q;  2JA6 B;  2GVB A;  3I7F A;  5C44 B;  4FO2 A;  4RCN A;  1PRT B;  1U4L A;  2F0D A;  1D6E C;  2PMZ E;  3GTM H;  1ESR A;  1L0X B;  2PW5 A;  3KF6 A;  1MJC A;  2EDG A;  4OWT B;  4BY1 G;  4F88 A;  5FOB B;  2Q2T A;  2YYZ A;  1STB A;  2EJM A;  3P1H A;  1J9O A;  4IO9 A;  4O0A A;  1RL2 A;  1BO0 A;  1PZK D;  2XIW A;  1QIL A;  1EFW A;  4XQQ A;  2L12 A;  2OQK A;  3D0F A;  3QJY A;  1XPR A;  4X65 L;  2BH2 A;  4FXD A;  4XTC S;  2IL8 A;  4HID A;  1WTH A;  2KVM A;  1CA5 A;  1CKM A;  3I4N H;  3OMC A;  1TWA B;  1QOH A;  4P2C B;  1PTO C;  1R4P B;  4DGZ A;  3LX0 A;  1I50 H;  4CKC A;  3AFQ A;  5FO8 B;  4QGU A;  1XNR Q;  3B6Y A;  1U4M A;  4DR4 Q;  4MNO A;  1IBL Q;  4X62 Q;  2OT2 A;  3J80 i;  2QA4 A;  2NZO A;  1WTR A;  4OX9 L;  4OL7 A;  1QZG A;  4KHZ A;  1ESF A;  4YCV A;  3JAM E;  3I70 A;  2UXC Q;  1FNW A;  4G7H C;  1E7Z A;  1SNP A;  1S5E D;  4DV6 Q;  4IOC A;  2I5M X;  4G57 A;  3TEH B;  2C5C A;  2NVQ H;  2ZJP A;  4OHJ A;  4XT3 B;  1Z47 A;  2QGQ A;  3PMF A;  3SE0 A;  1V8Q A;  2F3I A;  2HCC A;  4APV A;  4GNX A;  3X3N A;  4A3K B;  1NMF A;  1Y1W H;  3TP6 A;  3J7A V;  2E2H B;  2JA7 H;  4C3I B;  4BY7 H;  2OEO A;  4RKL A;  4HSV A;  2MQH A;  5CV9 A;  4A3I B;  3M7N A;  1YNX A;  1XNR L;  1W6K A;  2YTX A;  3ND8 A;  1VQL A;  4DR4 L;  2O5I C;  1IBL L;  3BDO A;  3U4Z A;  4X62 L;  1DGS A;  1B7Y B;  4OEL B;  4IUN A;  1KD1 C;  2UXD Q;  5C4X G;  4LFC Q;  1I4P A;  3ULJ A;  2VZA A;  4JK1 C;  1PTO B;  2F0W A;  3QB3 A;  3MWY W;  5EJW A;  2JA8 G;  1T9H A;  1BKB A;  2UXC L;  4DR1 Q;  2JQO A;  1PFS A;  4MZ9 A;  3I91 A;  4DV6 L;  4IUR A;  4DV0 Q;  3KBG A;  3HOU H;  4OO1 G;  2RSN A;  4Z9C B;  1YHA A;  3K57 A;  3A55 A;  2VUM H;  3SR1 A;  1B8A A;  1NMG A;  2ZT9 C;  3A8K E;  5E3F A;  3JAM L;  2QF7 A;  3BS1 A;  5D65 A;  1FD7 D;  2R7Z B;  2IHE A;  1SYB A;  5C0X H;  1YHQ A;  3PUV A;  4LUO A;  3CW2 C;  3MXN B;  1SMY C;  2B2Y C;  1HPC A;  2UUA Q;  4C56 C;  2I5H A;  4R1J A;  3C1E A;  3VYT A;  3R2I A;  4LF9 Q;  4HMI A;  1UE6 A;  4LW1 A;  5I6Y A;  1IXR A;  4C3H H;  3K59 A;  2KUM A;  3HOX B;  2I07 B;  5EGT A;  5DNF A;  2VQE Q;  4IUT A;  4ME5 A;  4O1N A;  3KOJ A;  4A3F H;  4IUU A;  2UXD L;  1SYE A;  4FYD A;  4LFC L;  3HOZ B;  5FLX c;  2RDG A;  4A3J B;  3STB D;  3DHQ A;  3GTP B;  2X6L A;  2KCT A;  3GDE A;  4IFD J;  1GUG A;  1OXS C;  4ALP A;  4DR1 L;  4UHV A;  3T1Y Q;  2SNM A;  2Z0S A;  2QDL A;  2WAQ G;  3LWU A;  5I2X A;  1D5X C;  4BBR H;  1CZG A;  5JAV A;  3CC2 A;  4RGN A;  2KEN A;  2KQ3 A;  1E2Z A;  1TY2 A;  3H0G B;  2K32 A;  3S14 B;  2B2U C;  1B2T A;  1BUV T;  2B39 A;  2KA7 A;  3NUC A;  5HGT A;  1IYU A;  1LTS D;  1PMR A;  2EYO A;  3IRB A;  4HN7 A;  1X3G A;  5KRU A;  4BBS H;  3OSO A;  5CC4 A;  2UUA L;  4DV7 Q;  1ICW A;  4LF9 L;  1YBY A;  4F8M A;  4PV1 C;  2DY7 A;  2VQF Q;  5C5L A;  2NVX H;  2Z6K A;  4QF4 A;  3S1R H;  1NR4 A;  1T5E A;  1Y8P B;  2ZTE A;  5DM6 3;  3PO3 H;  1TWH B;  4E6I A;  1SYF A;  1JOR A;  2VB2 X;  1B4O A;  2F4V Q;  2RQX A;  3A0J A;  1C0A A;  1KDB A;  1BBX C;  3L7Z C;  2F0T A;  1Q86 C;  1IL8 A;  2IX3 A;  3J7A 5;  1LTT D;  3NEL A;  4DAP A;  3J81 L;  3I4N G;  4K5W A;  1GHK A;  1L1O C;  1WD1 A;  2ATW A;  4K2K A;  2B63 H;  4A3G H;  1Y14 B;  1YNN C;  4G7O C;  1FJG Q;  4H13 C;  2RA4 A;  3K58 A;  3M3Y H;  4X66 Q;  4IPH A;  1DJR D;  1C7Y A;  1PH1 A;  2PNH A;  1PH7 A;  1VMC A;  4A3B B;  1CQV A;  4OEM B;  1ENC A;  1A0I A;  4HMJ A;  5LMU Q;  2EYM A;  3EA6 A;  3ERQ A;  3NK9 A;  5JEA J;  3M9B A;  1Z6H A;  5FLX E;  4L5Q A;  4LUV A;  4KKU A;  4DR3 Q;  1STA A;  1EWH A;  3I56 A;  1LT6 D;  3AFP A;  5HGQ A;  4ZUI A;  1G91 A;  4XQN A;  2F4V L;  4EQP A;  3F2D A;  2MGS A;  1C8C A;  3RZO B;  4JBJ A;  1Y1W G;  2ES2 A;  2HDM A;  3S2H B;  2QCP X;  3C46 A;  1GUT A;  4JC0 A;  1LAC A;  2JA7 G;  2Z1C A;  1HZA A;  3TSS A;  2NZH A;  2KOL A;  4A3M B;  2OQ0 A;  4BY7 G;  1AH9 A;  2F0S A;  1DON A;  1FJG L;  3PIP 3;  1A6X A;  1UEA B;  4QMG A;  3T4A C;  3CF5 A;  1LTA D;  4ODG A;  4X66 L;  2Q2U A;  3MVV A;  3DWA A;  3T56 B;  1L1O B;  1RHP A;  1Q3L A;  1TWA H;  2DJF C;  3E9H A;  1GKH A;  2RSO A;  4BA1 I;  5LMU L;  4LF8 Q;  2TSS A;  4DNI A;  4OWX B;  2K1B A;  3E0J A;  2F3W A;  5FO9 B;  1QNU A;  1CM9 A;  3HOU G;  1D5M C;  4A3C H;  4DR3 L;  2OF1 A;  3K5N A;  1FVI A;  1AN8 A;  4O2D A;  1TWF B;  1EUJ A;  3NTH A;  3VA7 A;  4NB3 A;  4CDD C;  3GTQ B;  5C0X G;  2XWJ B;  2A69 D;  3D3R A;  1G2T A;  2Q8T A;  1SFO B;  3A5U A;  4QIW B;  1Y69 U;  3L0O A;  2VY3 A;  3O13 A;  3ICE A;  1EIY B;  3BVG A;  1EWI A;  2N49 A;  3G6E A;  4RHS A;  4C3H G;  2CWA A;  4LMQ D;  2WFW A;  3PO2 H;  2L5T A;  2B2V C;  3A5Z B;  4J6H A;  1LTL A;  1IYV A;  3K0Y A;  4GNX B;  4A3F G;  2F0E A;  1E22 A;  5I2Y A;  2KED A;  4N9P A;  1JT8 A;  4LF8 L;  2H4O A;  4MTN A;  3OYY A;  3S1N B;  2E75 C;  3S1Q B;  2UXB Q;  2J7Z A;  3OW7 A;  3QOJ A;  3MTS A;  4XIG S;  4BBR G;  1MBY A;  4LJZ C;  4UDU C;  2PPB C;  4CGY B;  4OIK A;  1SE3 A;  2O2L D;  3NP8 A;  4DAY A;  3CRL C;  1RTO A;  2VL6 A;  4UY8 C;  4YHH Q;  1TS5 A;  3KJO A;  1IZ6 A;  5IT9 c;  4IUV A;  4BBS G;  4BS9 A;  5C4J B;  3VYR A;  3CCM A;  1K83 B;  3RD4 A;  5C3E H;  1P8L A;  3UDF A;  3CCU A;  1QWY A;  1GUO A;  1OTC A;  4AIM A;  3PO3 G;  2GVA A;  4QIW E;  2R92 H;  2JXM B;  4R4O A;  2XSC A;  3HFZ B;  1YJ9 A;  5ELB A;  2NVY B;  2WII B;  2ZJQ A;  3D8G A;  1X56 A;  4ZLT F;  4QY7 A;  4KJO A;  4POF A;  4P75 A;  4EQO A;  3A8J E;  1I94 Q;  2UXB L;  2LXJ A;  4U67 3;  2B63 G;  1H9R A;  2E8G A;  3N6R A;  5CR3 A;  4A3G G;  1B3Q A;  1ICF B;  1Q90 A;  3K80 C;  1WI5 A;  2RBM A;  1BCP B;  4K2L A;  1Y1V B;  4X3U A;  2VB3 X;  2EY1 A;  3FPP A;  3T51 B;  4RKB A;  4YHH L;  4LFB Q;  1YJN A;  5FK9 C;  1YEZ A;  2K5V A;  3S15 B;  2RVL A;  2EXZ A;  2ZXO A;  1KHI A;  3TP7 A;  4B3S Q;  1IHZ A;  3T16 A;  5IGD A;  3AQQ A;  3J81 i;  1XMQ Q;  2NZ1 D;  3HG9 A;  3CC7 A;  4K14 A;  1TT2 A;  3CXC A;  4P72 A;  1ENA A;  1TII D;  2X69 A;  1SN8 A;  2N3S A;  2PZT A;  1DOM A;  2MFI A;  2I0Q A;  1LO5 D;  1D8L A;  3I4O A;  3MA2 B;  2HQL A;  2RHS B;  2R6G A;  5AFW A;  3GTK H;  1I94 L;  5KYI A;  3TP8 A;  3ITP A;  2XRS D;  4Y7N B;  5IT9 E;  1R4Q B;  3IL8 A;  2K5H A;  1IW7 C;  1DOK A;  1F9R A;  2CH4 A;  1HTL D;  3FRP B;  3GV3 A;  5JJZ A;  2A1A A;  1STN A;  1F9S A;  2ZM6 Q;  2HHH Q;  2UUC Q;  5LL6 S;  4LFB L;  1X9N A;  5A2Q L;  3A56 A;  4IJH A;  3MHB A;  4LF4 Q;  3UDX A;  2JA5 H;  1E3P A;  2LXK A;  1S5D D;  2SNS A;  3K5O A;  3KLR A;  4A3C G;  1XMQ L;  2WV6 D;  1LAB A;  2KCC A;  4X3S A;  4FF3 A;  2MHV A;  3UE0 A;  1JE4 A;  2EYP A;  1JJ2 A;  4KI0 A;  5CV5 A;  5FLM H;  1ASY A;  2ASB A;  3CCL A;  5M5Y B;  1EEI D;  1MIU A;  1M8A A;  5COY A;  2HDL A;  2RCF A;  4HTH A;  1N34 Q;  2F4I A;  4AYB B;  2SDF A;  2B29 A;  1NSN S;  1QVC A;  2D0O A;  1SRO A;  3PO2 G;  4C2M B;  1IBK Q;  2A6E D;  3PQI A;  3S16 B;  1AP0 A;  2BCO A;  3GTO H;  3CAM A;  4GLX A;  3CC4 A;  2HHH L;  2UUC L;  2CW0 C;  1V43 A;  3W3A A;  1CA6 A;  5JJI A;  3D6W A;  1S40 A;  4LF4 L;  3S24 A;  2LKV A;  1IKL A;  1U4R A;  5BN5 A;  2AWO A;  3HKZ B;  4H7B A;  3RLO A;  4N9T A;  1RCV D;  5E1F A;  2ID0 A;  3CCS A;  3R3O A;  5C5M A;  5C0X J;  1KRT A;  4K5X A;  1J5E L;  2F0V A;  1BCP D;  4KD4 A;  2NTS A;  1XX8 A; 
#chains in the Genus database with same CATH homology
 3FEW X;  3I90 A;  3FMC A;  3T53 B;  2L0C A;  3KK7 A;  2A73 B;  1FYC A;  4A3D B;  3SXH A;  3C2P A;  3S2D B;  4ZKC B;  2HUG A;  4ZYS A;  2J0T D;  2B2W C;  5C6A A;  5CV7 A;  1CHP D;  2DN8 A;  2Q8R E;  3UI2 A;  1GOZ A;  4CBV A;  4XYQ A;  5C3X A;  1UAP A;  5EKI A;  1EZ6 A;  3AMU A;  1FGB D;  3NPP A;  1X32 A;  3MFG A;  4RAU C;  1EU4 A;  4I65 A;  5KYL A;  2G9H D;  2WB1 B;  3TBI B;  1ML0 D;  2A6H D;  2JEB I;  5E4W C;  1CHQ D;  2F03 A;  1STE A;  4B08 A;  5K36 H;  2IJ0 A;  1QJO A;  5ELD A;  3SVM A;  2K7V A;  1O80 A;  2NYZ D;  1SYC A;  3I4M B;  2A5H A;  1BR9 A;  1NAP A;  2MUY A;  3ERO A;  3HEJ A;  1RDP D;  1SDF A;  2C9O A;  2R61 A;  1JOO A;  5I9P A;  3QWN A;  4IAL A;  1QCB D;  1UNS A;  2LMC B;  2Z8L A;  4NMZ A;  2NN6 I;  5C4H A;  1OXX K;  1XTC D;  4ILW A;  4DXF A;  4FVM A;  2E76 C;  3A8I E;  3T13 A;  3J7A F;  2A74 C;  4DNR B;  1GHJ A;  1CZW A;  1CFM A;  1BF4 A;  3OPO A;  4RCO A;  3AB9 A;  5KNB A;  4IQZ A;  2EYH A;  4KY5 A;  4WJW A;  4CJ2 C;  1KAA A;  4HCS A;  5DEH A;  3M4O B;  1C4Q A;  2F0K A;  2R93 B;  2K05 A;  4KJN A;  1MGS A;  1R9T B;  5J22 A;  3RZD B;  4XXE A;  4IFD I;  3S1M B;  4FF1 A;  1CI3 M;  4F87 A;  1AZP A;  1PTO F;  4KD3 A;  2PQE A;  3BVZ A;  2AWN A;  2Z4I A;  1HA5 A;  4K8J A;  2B8G A;  5M9O A;  1HQR D;  3Q23 A;  3VR6 A;  4MIU A;  1LTI D;  5D14 A;  2B8F A;  4ZRZ A;  5JVH 3;  4RFB A;  1AW7 A;  3Q0A A;  1LT4 D;  3S17 B;  1TS2 A;  2AQ3 B;  1DCZ A;  1NCV A;  2XVS A;  1IKM A;  1PXU A;  3MZ5 A;  3Q6S A;  5M3M B;  1CK1 A;  3HOW B;  1LLR D;  3W2D A;  1PYW D;  4WRD A;  1WCM B;  3D6C A;  2MJ8 A;  4C3J B;  1C48 A;  4TSS A;  3NBI A;  2V4D A;  4LAA A;  3ND9 A;  4I7Z C;  1A3V A;  2EY5 A;  3CQZ B;  3DEP A;  3FVQ A;  3R8B A;  4DNT B;  1G8Z D;  3ZYY X;  1G6Z A;  4V19 0;  4Q0F A;  1EIH A;  3A54 A;  4B9W A;  1JCK B;  3SK4 A;  3OMG A;  1SYG A;  1PFB A;  2RDF A;  3WOE A;  4FP5 D;  4BY1 B;  1SEB D;  4FF4 A;  4LK1 C;  5K36 G;  2DNC A;  1TWC B;  5IGC A;  3NQT A;  3LWE A;  1X3Q A;  5J1Z A;  1ILP A;  2NUC A;  2NBF A;  5KGU A;  3DWP A;  3RMH A;  5I6W A;  1STH A;  1WVL A;  3NE5 B;  1ZKO A;  4IUQ A;  1H9K A;  4XQJ A;  4G4K A;  5CBE E;  1HRJ A;  2EVB A;  3EQL C;  3NQI A;  3BYT B;  5I9O A;  2K33 A;  1K8O A;  1EY4 A;  1SE2 A;  4RHR A;  1I6H B;  2F0P A;  4DK1 A;  1I4X A;  1HFN A;  3G7L A;  5IIF A;  2KCN A;  1KLU D;  3MFY A;  2WKC A;  3DEO A;  1SSO A;  1GJX A;  4DU9 A;  1XYI A;  2JP1 A;  3M4Y A;  2BA0 A;  3TME A;  1E2V A;  4FNF A;  5C4X B;  2ZXP A;  1HUM A;  3DM1 A;  2XNA C;  2JA8 B;  4OO1 I;  1BOS A;  3SHL A;  4KKT A;  1I3Q B;  4KMU C;  3GTG B;  4TRD A;  1DXM A;  4M8A A;  4Q5V A;  2EJG C;  2NN6 H;  5FLX L;  2F0G A;  4PQX A;  1VCI A;  2WP8 J;  1UUP A;  1KDC A;  1EY9 A;  1K8M A;  3MXG A;  5CV8 A;  2LS0 1;  2SEB D;  1JWS D;  2JYO A;  1WTW A;  3QIA A;  4X3K A;  3IFT A;  2JEA I;  1BCP C;  3CU7 A;  1SNC A;  2CVR A;  2PNR C;  3HRZ C;  2YU9 B;  3BYY B;  2WAQ B;  3SK8 A;  3KLS X;  1JC7 A;  4DXG A;  4RA8 A;  1PTO H;  3OOC A;  4QUF A;  5IGB A;  4PMB A;  4ZKB B;  2L9H A;  1J8I A;  2M2L A;  3OIQ A;  1I4G A;  3GTM B;  4L6T B;  1I4H A;  3NTI A;  1TY0 A;  2D9U A;  2AUK A;  1OXT A;  2EYJ A;  4CHT B;  2B2T A;  1V1P A;  1ET9 A;  3J80 E;  2HQE A;  1GUW A;  2KEC A;  3I4N B;  2F0J A;  2A6H C;  2EE1 A;  2NWG A;  2OXP A;  1I50 B;  3VR4 A;  3VA5 A;  1ET6 A;  3FDT A;  1TS3 A;  2F0H A;  2K28 A;  1Z7T A;  1MI2 A;  2L11 A;  3A7L A;  2E74 C;  1ROD A;  1WTO A;  1FNU A;  3N52 A;  2KJX A;  4QB4 A;  2NVQ B;  4X3T A;  2BDN A;  4KN7 C;  3QG1 A;  1PZI D;  2FFK B;  4ZAI A;  1EY5 A;  4NP5 A;  5JEA H;  4DN4 M;  4PNY A;  4RGO S;  1Y1W B;  4XT1 B;  1Q1E A;  2IT1 A;  2JA7 B;  4BY7 B;  1DOL A;  3I72 A;  3IFD A;  1D1K A;  2K6A A;  5TSS A;  1NR2 A;  3CRK C;  3V96 A;  1H9S A;  3K6O A;  4U68 A;  3NHH A;  3FPU B;  3X3M A;  5G3L F;  1B9N A;  3D4D A;  3DWQ A;  3KBX A;  2ZXR A;  5KNC A;  5D3I B;  2VNU D;  1SNO A;  1D5Z C;  1E0B A;  3HOU B;  4K8I A;  1X3P A;  4C1N I;  1DZ1 A;  5C0X I;  1XXG A;  1EYD A;  2NN6 G;  3GD7 A;  3IKJ A;  2XWB B;  2H1E A;  3HP3 A;  1B3A A;  1HA6 A;  5DM7 3;  4RH6 A;  4C3H B;  2D2C C;  2TMP A;  1KDA A;  1QG7 A;  4HAE A;  5EPJ A;  2E2D C;  4A3F B;  4C3I G;  1STY A;  1D2B A;  5A35 A;  5IT9 L;  5D3D A;  5EBD A;  2F0F A;  5KND A;  2HCI A;  2KHS A;  4BBR B;  2QIL A;  5JOB A;  1HHV A;  3MEH A;  1WTV A;  1BQQ T;  2FMC A;  3KF8 A;  2WAC A;  1TKW B;  1WTP A;  1ZEQ X;  2IX0 A;  4BBS B;  1WTQ A;  1GUS A;  2JE6 I;  3C3L A;  2B2Y A;  1A3U A;  3NXW A;  2NVX B;  3S1R B;  3P75 A;  1OXV A;  1SJH D;  1EQT A;  3PO3 B;  5IGF A;  3K5L A;  1JOQ A;  1JWU D;  1Q1B A;  1EYC A;  4KY6 A;  3HS0 C;  1Q12 A;  3MC0 B;  1O7L A;  5JPN C;  3EJI A;  4G7Z C;  2PYK A;  1EYA A;  1QNK A;  2B63 B;  1A15 A;  4A3G B;  5EQ0 A;  3OWF A;  1EY7 A;  5CV6 A;  1ILQ A;  5COR A;  3F2U A;  3I8Z A;  4R9W A;  5IGE A;  1CT1 D;  3M3Y B;  4FXK C;  5BN3 A;  3GTL B;  4KV6 A;  1G29 1;  1PRT F;  2B2U A;  1VMP A;  3I4L A;  5C4Z A;  1AFP A;  4KTA A;  1RJT A;  1GUN A;  1SAP A;  5CV4 A;  5EKL A;  2L1B A;  4FXG C;  1S5B D;  3BDL A;  3NWT A;  5JEA G;  3CHB D;  3MAQ A;  5G3L D;  3WOF A;  1E2W A;  2PO4 A;  2D62 A;  4ZQ3 A;  4H0L C;  1TR5 A;  1RKN A;  1V1P B;  3PUZ A;  5KIX A;  1GXD C;  2K5W A;  4GZY C;  1Y8O B;  4ID6 A;  3QOL A;  5CBA E;  2BE5 D;  1II3 A;  1F9P A;  1PZJ D;  1EQV A;  5ELF A;  3A7A B;  2EPB A;  5NUC A;  5K5P A;  2G9D A;  3H3V C;  5EPL A;  3MXU A;  4KHV A;  3VYU A;  4EGV A;  3AU7 A;  1T5X D;  1EY6 A;  2QKI C;  5M5X B;  1SNM A;  3I73 A;  2FIN B;  3NSW A;  2RDH A;  1L0Y B;  3S9W A;  1EEF D;  1IW7 D;  4JBW A;  3U9O A;  1LT3 D;  2PZU A;  3PO2 B;  3FKI B;  3GP7 A;  4H44 C;  5ISR A;  2A69 C;  1I4Q A;  2EY2 A;  1EWC A;  1HQM C;  2FMM A;  3L9A X;  5FO7 B;  4DFA A;  4CJ1 B;  1YNJ D;  2F0M A;  3SK5 A;  3HZX A;  1B50 A;  1LV9 A;  3E5S A;  1H9S B;  1JOK A;  4IUP A;  1EY0 A;  1DD2 A;  3DXJ C;  1VF7 A;  1KNA A;  1EIG A;  2MP1 A;  1KAB A;  2F0L A;  4PMC A;  1U9R A;  1EU3 A;  2N88 A;  4J1M A;  1CTM A;  1EY8 A;  2GA4 B;  2DNE A;  3WDN A;  3LNN A;  4YIJ A;  3D31 A;  5C3E B;  3QO2 A;  1PDQ A;  1PLF A;  1KTK A;  2CW0 D;  4C1N K;  2R92 B;  1F2M A;  2QEJ C;  3TZD A;  2B2V A;  4K5V A;  1PRT D;  1JB3 A;  1ZYR D;  3J81 E;  1O7Y A;  4RGT A;  4TQU S;  1A2U A;  4HCE A;  5LL6 X;  3DUZ A;  1DM0 B;  3RUZ A;  1TS4 A;  1Y8N B;  3TDQ A;  2LY7 A;  1QB5 D;  2J4X A;  1SE4 A;  1TVX A;  1I4R A;  3SDZ A;  1EFI D;  3VR5 A;  1O7Z A;  1HCZ A;  2F0U A;  5LHY 1;  3OHX C;  1B9M A;  2CQA A;  2FJ2 A;  2F0O A;  4RWS C;  2FHT A;  2IWH A;  2K04 A;  5BN4 A;  2A68 D;  3OWE B;  3D4R A;  2WIN B;  1JQY D;  1TU2 B;  4FF2 A;  4R8N A;  2ICE C;  4L8J A;  3GTK B;  1KNE A;  2BDO A;  2K03 A;  5I4D A;  2F0Q A;  5J39 A;  4KKS A;  4NW2 A;  1A2T A;  1H9M A;  1SYD A;  3BVM A;  3SEB A;  5EKK A;  3H94 A;  3G6J B;  2JA5 B;  4XYO A;  3KUP A;  4WOR A;  1ZXT A;  1NUC A;  1FNV A;  5KEE A;  2EYL A;  3URY A;  1PTO D;  1BXT A;  2AQ1 B;  2NTT A;  1G2S A;  2M00 A;  1F2L A;  3I3C A;  1ENF A;  3Q22 A;  5ELE A;  1QE6 A;  1HTP A;  2IPK D;  3BG3 A;  2AUJ D;  5DAU A;  4CKB A;  1WTX A;  1W6J A;  5CYU A;  3GTO B;  4OGQ C;  1PFM A;  2PW7 A;  1WD0 A;  3TZU A;  3V05 A;  3GQB A;  1MD2 D;  4MHE A;  3BZD B;  2A6E C;  2M9V A;  1LTR D;  2EJF C;  1SJE D;  2N55 A;  1RD9 D;  4B9X A;  1S5C D;  1B44 D;  3RLF A;  3PUY A;  4UAI A;  5IOD A;  4KY7 A;  5HUR A;  2X6G A;  4BWG B;  3VYS A;  4CKE A;  2RKS A;  1U4P A;  3GTJ B;  4RGM A;  4J8Q A;  3NBH A;  2EOT A;  4M1U B;  1TQO A;  3EFX D;  1FR3 A;  1SBB B;  4PMW A;  4MN3 A;  5IOC A;  2O4X A;  2F0N A;  1SMY D;  4IFD H;  2AQ2 B;  1RTN A;  2EZV A;  4ABN A;  1SXT A;  3PUX A;  1ONL A;  1LTB D;  3E6Z X;  4KN4 C;  2XRQ D;  2Y0S B;  2LFN A;  1DYQ A;  5T1G A;  2I46 A;  2K5D A;  2QDB A;  3R2T A;  3BDC A;  1EZ8 A;  5E4X A;  4ULL A;  1JIC A;  1F2Z A;  5M3F B;  1V1O A;  4K6D A;  2BA1 A;  2JSO A;  1BNZ A;  1S5F D;  4DF7 A;  2B2W A;  3PIO 3;  3PV0 A;  1BCP F;  1LT5 D;  2E2J B;  5M5W B;  2XN9 C;  1RF2 D;  3EVQ A;  3R93 A;  1TWG B;  1B53 A;  1SND A;  2DY8 A;  4WFN 3;  4ZUJ A;  5A2Q E;  4KK7 A;  3OIP A;  1STG A;  4QUC A;  3VR3 A;  5EPK A;  3CKI B;  1M4V A;  3P20 A;  3GO5 A;  2K01 A;  3KLS A;  4BA2 I;  2F1M A;  2F0I A;  4HR7 B;  1HFG A;  5IGG A;  3J7Y W;  2BE5 C;  2IW3 A;  4K6L A;  3D4W A;  1YNN D;  1B1Z A;  3J80 L;  2Z4H A;  1A3T A;  2Q8I B;  3DMU A;  1JWM D;  4TKO B;  3M85 A;  4ZK9 B;  4L63 B;  1D1I A;  5CGK A;  5C3W A;  1JR0 D;  1AEX A;  1KLG D;  4EVO A;  5FKA C;  4NDX A;  3H09 A;  2KEE A;  2IX1 A;  1HXY D;  1H9J A;  3ONA B;  4IZ8 A;  3NWS A;  1OO9 B;  3GV6 A;  3TP5 A;  4OIJ A;  2VUM B;  1S4Z A;  3HOV B;  4QCL A;  2NB0 A;  5EBC A;  2R3Z A;  4R8I A;  3MXN A;  2O5J C;  3L3O C;  5CMD A;  2K5Q A;  2EY6 A;  4CJ0 B;  1Q8I A;  1YNJ C;  4A93 B;  2BOS A;  5ELC A;  3U9S A;  4V0B A;  1XWE A;  1HUN A;  3K5M A;  4A3E B;  2WKD A;  2D5D A;  1VDZ A;  1CQF A;  3PUW A;  4IN3 A;  3TN2 A;  3M7G A;  5T1I A;  3SK6 A;  1F9Q A;  3VR2 A;  4IFD G;  4DAV A;  3HOY B;  2PCF B;  3H6M A;  2VXW A;  1BDO A;  4OO1 H;  1MSG A;  3H91 A;  2ICI A;  3K7A B;  1PRT C;  1O78 A;  2NVT B;  1PFN A;  3Q24 A;  2PMZ B;  3MXP A;  3NTK A;  1ZYR C;  4EQN A;  2SOB A;  2B2T C;  5JPM C;  2MPM A;  1AZQ A;  2L55 A;  4HED A;  1OXU A;  1F77 A;  4DK0 A;  4HSP A;  2E2I B;  2PZW A;  2F3V A;  2ENB A;  5F2D A;  5JVG 3;  3P7J A;  1LTG D;  3HGB A;  4S3S A;  3V2T A;  1SNQ A;  3C1F A;  2A68 C;  4C3J G;  1EL0 A;  4NKL A;  4DA2 A;  2CHB D;  1F2Y A;  1MSH A;  2EYF A;  1VF5 C;  4F7X A;  1I6V C;  4O42 A;  1EOT A;  2L4N A;  3IAY A;  4XDX A;  2JA6 B;  5C44 B;  4FO2 A;  4RCN A;  1PRT B;  1U4L A;  2F0D A;  1D6E C;  1ESR A;  1L0X B;  2PW5 A;  2EDG A;  4F88 A;  5FOB B;  2YYZ A;  1STB A;  2EJM A;  3P1H A;  1J9O A;  1BO0 A;  1PZK D;  2XIW A;  1QIL A;  4XQQ A;  2L12 A;  3QJY A;  4FXD A;  4XTC S;  2IL8 A;  2KVM A;  1CA5 A;  3OMC A;  1TWA B;  1QOH A;  4P2C B;  1PTO C;  1R4P B;  4DGZ A;  3LX0 A;  4CKC A;  5FO8 B;  1U4M A;  2OT2 A;  1WTR A;  4OL7 A;  4KHZ A;  1ESF A;  3JAM E;  3I70 A;  1FNW A;  4G7H C;  1SNP A;  1S5E D;  4G57 A;  2C5C A;  4OHJ A;  4XT3 B;  1Z47 A;  3PMF A;  3SE0 A;  1V8Q A;  2HCC A;  3X3N A;  4A3K B;  3TP6 A;  3J7A V;  2E2H B;  4C3I B;  2OEO A;  4RKL A;  4HSV A;  5CV9 A;  4A3I B;  3M7N A;  1W6K A;  3ND8 A;  2O5I C;  3BDO A;  4IUN A;  1I4P A;  4JK1 C;  1PTO B;  2F0W A;  3QB3 A;  3MWY W;  5EJW A;  3I91 A;  4IUR A;  3KBG A;  4OO1 G;  2RSN A;  4Z9C B;  3K57 A;  3A55 A;  3SR1 A;  2ZT9 C;  3A8K E;  5E3F A;  3JAM L;  2QF7 A;  3BS1 A;  5D65 A;  1FD7 D;  2R7Z B;  1SYB A;  5C0X H;  3PUV A;  1SMY C;  2B2Y C;  1HPC A;  4C56 C;  3C1E A;  3VYT A;  3R2I A;  4HMI A;  5I6Y A;  3K59 A;  2KUM A;  3HOX B;  2I07 B;  5EGT A;  5DNF A;  4IUT A;  4ME5 A;  4O1N A;  4IUU A;  1SYE A;  4FYD A;  3HOZ B;  2RDG A;  4A3J B;  3DHQ A;  3GTP B;  2X6L A;  4IFD J;  1GUG A;  1OXS C;  2SNM A;  3LWU A;  5I2X A;  1D5X C;  1CZG A;  5JAV A;  4RGN A;  2KQ3 A;  1E2Z A;  1TY2 A;  3H0G B;  2K32 A;  3S14 B;  2B2U C;  1B2T A;  1BUV T;  2B39 A;  2KA7 A;  3NUC A;  5HGT A;  1IYU A;  1LTS D;  1PMR A;  2EYO A;  4HN7 A;  5KRU A;  3OSO A;  5CC4 A;  1ICW A;  4F8M A;  4PV1 C;  2DY7 A;  5C5L A;  4QF4 A;  1NR4 A;  1T5E A;  1Y8P B;  5DM6 3;  1TWH B;  4E6I A;  1SYF A;  1JOR A;  2VB2 X;  1B4O A;  2RQX A;  1KDB A;  1BBX C;  3L7Z C;  2F0T A;  1IL8 A;  2IX3 A;  1LTT D;  4DAP A;  3J81 L;  4K5W A;  1GHK A;  1WD1 A;  4K2K A;  1YNN C;  4G7O C;  4H13 C;  2RA4 A;  3K58 A;  1DJR D;  1VMC A;  4A3B B;  1CQV A;  1ENC A;  4HMJ A;  5JEA J;  2EYM A;  3EA6 A;  3ERQ A;  3NK9 A;  1Z6H A;  5FLX E;  4KKU A;  1STA A;  1EWH A;  1LT6 D;  4ZUI A;  1G91 A;  4XQN A;  4EQP A;  2MGS A;  1C8C A;  3RZO B;  2HDM A;  3S2H B;  2QCP X;  3C46 A;  1GUT A;  1LAC A;  2Z1C A;  3TSS A;  2KOL A;  4A3M B;  2F0S A;  1DON A;  3PIP 3;  1A6X A;  1UEA B;  4QMG A;  3T4A C;  1LTA D;  4ODG A;  3MVV A;  3DWA A;  3T56 B;  1RHP A;  1Q3L A;  2RSO A;  4BA1 I;  2TSS A;  2K1B A;  3E0J A;  2F3W A;  5FO9 B;  1QNU A;  1CM9 A;  1D5M C;  2OF1 A;  3K5N A;  1AN8 A;  1TWF B;  3NTH A;  3VA7 A;  3GTQ B;  5C0X G;  2XWJ B;  2A69 D;  3D3R A;  1G2T A;  2Q8T A;  1SFO B;  4QIW B;  1Y69 U;  3O13 A;  3BVG A;  4RHS A;  4C3H G;  4LMQ D;  2L5T A;  2B2V C;  4J6H A;  1IYV A;  3K0Y A;  2F0E A;  5I2Y A;  2KED A;  4N9P A;  2H4O A;  3S1N B;  2E75 C;  3S1Q B;  2J7Z A;  3OW7 A;  3QOJ A;  3MTS A;  4XIG S;  1MBY A;  4LJZ C;  4UDU C;  2PPB C;  4CGY B;  4OIK A;  1SE3 A;  2O2L D;  3NP8 A;  4DAY A;  3CRL C;  1RTO A;  1TS5 A;  4IUV A;  4BS9 A;  5C4J B;  3VYR A;  1K83 B;  3RD4 A;  1QWY A;  1GUO A;  2JXM B;  2XSC A;  5ELB A;  2NVY B;  2WII B;  3D8G A;  4ZLT F;  4KJO A;  4EQO A;  3A8J E;  4U67 3;  1H9R A;  3N6R A;  5CR3 A;  1Q90 A;  2RBM A;  1BCP B;  4K2L A;  1Y1V B;  4X3U A;  2VB3 X;  2EY1 A;  3FPP A;  3T51 B;  4RKB A;  5FK9 C;  3S15 B;  2RVL A;  2EXZ A;  2ZXO A;  3TP7 A;  1IHZ A;  3T16 A;  5IGD A;  2NZ1 D;  3HG9 A;  4K14 A;  1TT2 A;  1ENA A;  1TII D;  2X69 A;  2PZT A;  1DOM A;  1LO5 D;  3MA2 B;  2R6G A;  5AFW A;  5KYI A;  3TP8 A;  3ITP A;  2XRS D;  4Y7N B;  5IT9 E;  1R4Q B;  5JJZ A;  3IL8 A;  1IW7 C;  1DOK A;  1F9R A;  3GV3 A;  1HTL D;  3FRP B;  1STN A;  1F9S A;  5LL6 S;  5A2Q L;  3A56 A;  3MHB A;  1S5D D;  2SNS A;  3K5O A;  3KLR A;  2WV6 D;  1LAB A;  2KCC A;  4X3S A;  4FF3 A;  2MHV A;  1JE4 A;  2EYP A;  4KI0 A;  5CV5 A;  5M5Y B;  1EEI D;  1M8A A;  5COY A;  2HDL A;  4HTH A;  2F4I A;  4AYB B;  2SDF A;  1NSN S;  4C2M B;  2A6E D;  3S16 B;  1AP0 A;  2BCO A;  2CW0 C;  1V43 A;  3W3A A;  1CA6 A;  3D6W A;  2LKV A;  1IKL A;  1U4R A;  5BN5 A;  2AWO A;  3HKZ B;  4H7B A;  4N9T A;  1RCV D;  5E1F A;  2ID0 A;  3R3O A;  5C5M A;  5C0X J;  4K5X A;  2F0V A;  1BCP D;  4KD4 A;  2NTS A;  1XX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...