1A15A

Sdf-1alpha
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
67
structure length
67
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPACALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMAL DERIVED FACTOR-1ALPHA
publication title Crystal structure of chemically synthesized [N33A] stromal cell-derived factor 1alpha, a potent ligand for the HIV-1 "fusin" coreceptor.
pubmed doi rcsb
molecule tags Chemokine
total genus 8
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1a15A00
2K28A 2K05A 1NR4A 5EKIA 2EPBA 1B3AA 3DEOA 1ILQA 4RWSC 5E4XA 1SAPA 4X3UA 2L11A 4ZAIA 4ZK9B 3I3CA 3DM1A 2RSOA 3SVMA 3I90A 1BF4A 2H1EA 2Q8RE 1XYIA 1GUWA 4QUCA 1KNEA 5EPJA 5EQ0A 2RA4A 1G6ZA 5T1GA 2K04A 3N52A 1O7YA 2D9UA 1EIGA 1RTNA 1TVXA 2HCIA 1MI2A 2B2TA 1HFGA 2X6LA 2KECA 3I8ZA 1B50A 4ZKCB 2L9HA 2FHTA 5EPLA 1PFBA 2CVRA 4CJ1B 2KUMA 2R3ZA 1O80A 1F2LA 3IFDA 1ZXTA 4DN4M 1QE6A 1HUNA 4X3KA 1RTOA 1PFMA 2N88A 1X3PA 2FINB 2KOLA 1BBXC 1B4OA 5EJWA 1AZQA 2DY8A 1WVLA 1AZPA 1C8CA 1ICWA 1U4MA 1DOKA 5D14A 4IUVA 1WTXA 4CJ2C 2HDLA 1JICA 1PFNA 3G7LA 1DOLA 3GV6A 4IURA 1F9RA 2L4NA 2J7ZA 4X3TA 3KBXA 4MHEA 2B2UA 4MN3A 1IL8A 2EE1A 3HP3A 2BDNA 4CJ0B 1X3QA 5CBAE 2JP1A 1HRJA 2B2TC 3I91A 2MJ8A 4O42A 1MSHA 2N55A 2FJ2A 1MGSA 2KVMA 1SSOA 1Q3LA 1HA6A 1NAPA 4IUUA 4ZKBB 1NR2A 1F9SA 1AP0A 1VMCA 1PDQA 2B2WA 3TZDA 3FDTA 1F9QA 2Q8TA 2K1BA 1DOMA 3KUPA 2M2LA 3P7JA 1B2TA 3MTSA 1HUMA 1G2SA 2HDMA 3MWYW 3ONAB 2B2YA 1A15A 4IUTA 4IUQA 4R8IA 5DNFA 2NZ1D 1J8IA 2FMMA 4HAEA 4R9WA 2IL8A 1ESRA 2B2UC 1BNZA 4HSVA 3TN2A 4UAIA 2NYZD 2EOTA 1BO0A 2RSNA 3H91A 1DONA 3Q6SA 1EOTA 1X32A 1F9PA 1U4PA 4HCSA 2MPMA 1RODA 2B2VA 3FPUB 4XDXA 5JJZA 1WTRA 1WD1A 5AFWA 4RAUC 1CA6A 1VMPA 4X3SA 1U4RA 2JYOA 5CMDA 2X69A 2KEEA 5EPKA 1WTWA 1NCVA 3F2UA 3IL8A 1WTOA 2HCCA 2L1BA 1HHVA 2B2WC 4RA8A 2L12A 5COYA 1IKMA 1G2TA 4XT1B 2DY7A 4XT3B 1CA5A 3D6WA 1WTPA 2HUGA 1M8AA 5CORA 1EIHA 1U4LA 2K03A 1WTVA 2B2YC 2NWGA 3GV3A 2MP1A 1J9OA 4OIKA 1DZ1A 1WTQA 1EQTA 4LMQD 4QUFA 4OIJA 5T1IA 1B53A 1KNAA 1PLFA 1RJTA 1O7ZA 1XX8A 1WD0A 2FFKB 3R93A 1RHPA 1ML0D 1LV9A 1G91A 1QG7A 3DEPA 1E0BA 1S4ZA 5E4WC 2VXWA 5CBEE 2B2VC 3QO2A 1ILPA 4IUPA 1HFNA 2X6GA 2MGSA 2RVLA 1QNKA 1JE4A 2KEDA 4HEDA 4NW2A 3LWEA 1CM9A 2SDFA 3UI2A 1MSGA 1EL0A 5D65A 2K01A 4U68A 1SDFA 2XIWA 4ZLTF 1IKLA
chains in the Genus database with same CATH superfamily
4A3MG 1BCPD 1B3AA 2VY3A 2F0NA 4RWSC 1O78A 3HKZE 3AEVA 4A3LG 2SOBA 3KLSX 4DUYQ 1L0YB 2IWHA 4LF5Q 3NUCA 1HZBA 5DM63 3G4SA 4LFCQ 5JEAG 4A3CH 1LUZA 2HD3A 3EA6A 2I5LX 4F8MA 1U9RA 3I8ZA 3MFYA 1B50A 1TXYA 2K33A 4LF8Q 2R3ZA 4B3SL 2JA5B 1HZAA 2IJ0A 1FJGQ 1VS0A 3EJIA 2K5DA 4JG2A 4C56C 3M85A 4CJ2C 2BDOA 1A3VA 3BZCA 3W2DA 5C4XB 1VQ7A 2B2UA 3NBHB 5KNDA 2NN6H 2N8NA 5E1FA 3TSSA 5GADC 1UEBA 2NVQB 1OXTA 4NXML 2Z6KA 3S2DB 4MTKA 4IFDI 3PV0A 4YCWA 5FK9C 1F9SA 3U9OA 2Q2IA 1H9SB 2AQ3B 4LUVA 2C35B 1XNQQ 3MXNB 4A3JB 1B2TA 1HQRD 3E0EA 3HS0C 2R93G 2KHSA 3L9AX 4X65Q 1SNQA 1H9RA 2MUYA 3HOWB 1XXGA 3I4OA 3TN2A 3MEFA 3NELA 1Q82C 1EOTA 5JJZA 5G3LF 3CP0A 2OEOA 1R4QB 2X69A 4CBVA 3GTQH 3BG3A 3NQTA 4P73A 1UEAB 2SNSA 5IP7H 1EQVA 2JJQA 2K03A 1I50B 5C44H 1LT5D 4C3HH 1O7ZA 3I4LA 2JA8G 2BOSA 4R8NA 1OXSC 1SNCA 4CDEC 2UXBL 5K5PA 2B2VC 2ZXOA 4GKKL 5I2XA 4P72A 2KBNA 4IUPA 4HCEA 4UHVA 3T13A 2KEDA 3J81i 3MAQA 4JI4L 4BBSH 1WCMB 2K01A 3GTPB 5CYUA 3AYHB 4IQZA 1GUNA 2L11A 4QIWB 3K5LA 1KDAA 4DU9A 3NPPA 5ELCA 2DNCA 2X6LA 4PNYA 3SK4A 2ZM6Q 2DJFC 4JI4Q 4GLXA 1FGBD 2EY2A 1PVOA 3K8AA 1LT3D 1DD2A 4IPGA 2N88A 4FF3A 3D8GA 4GNXC 1QCBD 4BY1H 4IJLA 4A3EG 1TQOA 5AJ3Q 1X55A 2HDLA 3S1QH 2RBMA 4DV2L 5A35A 4X3TA 4ULLA 4JI6Q 2H5XA 2GA4B 1KLGD 1LYLA 2LFNA 3ND9A 1PZKD 4FP5D 5C5LA 3SE0A 1EY6A 1N34Q 2VB2X 1CHQD 1SSOA 3LNNA 2KQ3A 1UNSA 2OCEA 4LJZC 2K1BA 1KQSA 5J22A 4N9PA 2VQEL 4XYQA 4BXXH 5CV7A 1S72A 4LF4L 4C1NI 1WFQA 2WIIB 3J80i 4DV5Q 3R2IA 1VMPA 2N3SA 1JE5A 4ID6A 3GTOB 3DWPA 3IL8A 1AFPA 2L12A 3CCMA 1VCIA 2VQEQ 4B3RQ 1M8AA 1EIHA 5M5XB 3GV3A 3CCQA 1X65A 3HOUG 4LMQD 1QJOA 1PYWD 5G3LD 3GTLB 1Y1WH 1B53A 3H6MA 1KIXA 1SRUA 2WFWA 2FFKB 1E1TA 4XYOA 2PI2A 1E0BA 2A74C 4DPGA 4EQOA 4JYAL 1B1ZA 4R1JA 2X6GA 4FF4A 1SE8A 1A3TA 4DAPA 1X6OA 5C44B 2N49A 1TWFH 2EYLA 4L6TB 2EPBA 3K0XA 2Q2TA 4Y7NH 4FDBA 3F2BA 5JVH3 1WOCA 4OGQC 1BF4A 1GVPA 5LHY1 3LWUA 1GUWA 1B44D 2RQXA 4Q0FA 2PMZE 1O7YA 3NTIA 4JYAQ 4UDUC 4FXKC 4HMJA 5C4XG 1EWHA 5FJ8H 1JJGA 3I55A 1SFOB 4CJ1B 2F0VA 1F2LA 1IBKL 1Z7TA 1ENCA 1RTOA 3BDOA 1TIID 2DY8A 3J7ZC 1PV4A 1AZPA 1C8CA 2VUMH 2Q2UA 2BE5C 4IUVA 1LTGD 3T16A 4B3TQ 5EKLA 2BA0A 2J7ZA 5D3IB 1H95A 4A3JG 2Z4IA 2A69C 3T51B 2EJMA 4DV4L 5C3WA 3P75A 5C6AA 1MSHA 1IBKQ 2N55A 2Q2HA 3HOWG 1K8OA 1A8VA 1Q3LA 4JI5L 1QUQB 1N32Q 3TZUA 1A2UA 2ES2A 4DR4L 2Z8LA 1TWGH 3OMCA 3AFQA 3VR5A 3P7JA 1OXVA 2HDMA 1A15A 5D3DA 4KV6A 3CKIB 3S1RB 2BH2A 3K0YA 4BY7B 4DV4Q 1BVSA 2LKVA 2ID0A 1X9NA 1QVCA 1SE4A 2EYFA 3NTHA 4APVA 2NVXB 4MNOA 1WTRA 3PCOB 2A8VA 4JI5Q 2EZVA 3PGZA 1X3FA 5GQOA 1E3PA 1Y1VH 3H09A 1EYAA 4IALA 1Y8PB 1MBYA 1TWAH 3JC66 4IFDH 2WACA 2VS1A 1PFSA 5BR8L 4JVZA 4J15A 2UUAL 1NTGA 5CORA 2IHFA 4RGMA 1EY7A 2EY6A 2E2IH 4PQXA 4OX9L 1WCMG 4EQNA 3S24A 1PA6A 4UP9A 1EY0A 1S4ZA 1QVFA 5FO8B 2DNEA 5C0XI 1EZ6A 1QZGA 4HIDA 5BR8Q 1BXTA 1CM9A 1K3BC 1WTHA 1L0WA 4YWKA 1I6VC 4U68A 4POGA 4LW1A 2EYHA 4DAMA 4P2CB 4BBRH 4JI2L 2CW0C 4OX9Q 4EGVA 1CZWA 4JBWA 1SAPA 2HT1A 3I3CA 1SNDA 1CTMA 1VQJA 3T1YQ 1XYIA 2NVTH 1NY4A 5EQ0A 1MKHA 4N9TA 5T1GA 4A3IH 3N52A 2D9UA 5IOCA 1HR0L 3NTKA 1K8GA 1A2TA 1R4PB 1PTOB 4O1NA 4LAAA 1XJVA 2QEXA 1EQRA 4ZKCB 3PMFA 3GTMH 2KCTA 4Y7NB 4JI2Q 3J7YW 4DN4M 2L5TA 1QE6A 4IPCA 1I4QA 1IYJB 4R4QA 1KDBA 1YBYA 4KLKA 3I73A 1JICA 1STHA 2G9HD 2HQLA 1AE3A 3KBXA 1HXYD 1EEFD 2FMCA 2NN6I 2EE1A 2A5HA 3TP7A 2MO1A 2NUCA 2J4XA 4OL7A 2XVSA 2CH4A 4POFA 5CBAE 2EXZA 3OIQA 2BE5D 2PPBC 2R7ZB 1B70B 1YNXA 1VQ5A 1NR2A 1FNWA 5IGCA 3GTGB 2B2WA 4YHHQ 4DUZQ 1ZYRC 2A69D 5I6YA 1DGSA 3KUPA 4OEMB 1SJED 4JI8L 2JA6H 3FKIH 1PTOF 3ULLA 3GTJB 1M90C 5IGGA 3Q23A 3K80C 1W6JA 1DXMA 4HMIA 1YI2A 4CHTB 3TBIB 1ASYA 1PYSB 3S17H 4DR3L 1KRTA 4J1MA 1XMOQ 3CQZH 4RKBA 1HTLD 5IYDG 1L2FA 2RF4A 3K59A 2KCMA 3D6CA 4B9WA 5IIFA 3V96A 1L1OB 4LUZA 1EEID 2ASBA 3D4WA 3FHWA 2CHBD 4QIWE 3D0FA 3STBC 1UUPA 1J9OA 3NHHA 5FO7B 4QUFA 1E7ZA 5C44G 1XPRA 1C48A 2XSCA 1KABA 1KNAA 1XX8A 3KF8A 3RLOA 5BN5A 2YTYA 3B6YA 3DEPA 5CBEE 3ITPA 1D5XC 3S2HH 4GN3B 1JE4A 4GOPA 4G7OC 4Z9CB 3TREA 2UXCL 1GUOA 3SK5A 1IBLL 5EKIA 1NR4A 3OTOL 3M4YA 2R92B 3RUZA 2B63B 1V1PB 3KK7A 5I9OA 3AQQA 2EVBA 2V1CC 5GAHC 4ALPA 1SMXA 1G6ZA 4PV1C 2OTJA 2I0QA 1L1OC 1A62A 2CW0D 2CWAA 2PZTA 3ERSX 1IL2A 1CQFA 3GP7A 3VA7A 5JJKA 3PSIA 2E2JH 4R4IA 2XTIA 1I4HA 3X3NA 1HTPA 2FINB 5E3FA 5KEEA 2F0KA 4A3IB 1LABA 2ICIA 3HOVB 1NMFA 5IGDA 4A3GH 3GV6A 1HPCA 4K5XA 4PZ8A 4XQNA 2F0OA 3A56A 5CV5A 4C3IH 2B2TC 2I5MX 3CPFA 5IT9L 4BY7G 4GKJL 1ZEQX 1NUCA 1LLRD 4K5WA 4TKOB 3TRZA 3HKSA 4JOIC 5NUCA 2CH4W 3A0JA 3GTKH 3J7AF 4DR6Q 4HR7B 2WKCA 1HQMC 1VQPA 2F52A 1BNZA 4RCOA 3OW2A 2UXDQ 3H91A 3J7AV 1WJJA 4CDFC 1DONA 3Q6SA 2MPMA 4GKJQ 3I4MB 5M9OA 4A3EB 1PTOD 3VYUA 2PMZB 1EIFA 2JE6I 1CSPA 2KA7A 1N9WA 1PH8A 1NE3A 1NNXA 5C0XJ 4KHPL 2MO0A 1CA5A 2YYZA 3BJUA 5KIXA 4ZRZA 3HOYB 3WDNA 3MZ5A 1I4PA 5FLXL 1YITA 4JBMA 2N78A 2A1AA 5E4WC 3CPWA 2HIVA 1OTCA 3QO2A 3STBD 4YIJA 4OONA 2B3GA 1K73C 4KHPQ 3F8TA 2E74C 4ZLTF 1VQLA 4QUCA 1MIUA 2PQAB 3H3VI 2IPKD 3CCVA 4DR1Q 3DEOA 1ILQA 5IYCH 4DV6Q 2VNUD 4RKLA 2EYOA 4LFBQ 4NXNL 1K9MC 2I5HA 3A55A 4MZ9A 3E5SA 4F88A 4K0KQ 3TS0A 1DJRD 2UUCL 2QF7A 1WYDA 3BZKA 2AMCB 2F0UA 3SR1A 5FJ8G 5JOBA 1E2WA 1O80A 4KKSA 2E2HH 1NJIC 4X3KA 2IT1A 4BS9A 4FVMA 1AZQA 2CQOA 3ULJA 4KJNA 4UP8A 2R7ZG 3U4VA 5CV8A 4A3KH 4YWMA 4Y52H 1B8AA 4OO1I 3ZYYX 4DNIA 4MTNA 3RZOB 2VL6A 1IHZA 1N36L 5JPMC 2IY5B 4FO2A 3NSWA 1K28A 1PH7A 3A8JE 3M4QA 4DR7L 5IGFA 1G2SA 1EZ8A 2B2YA 1PZJD 2F0MA 3WOFA 5IT9E 2IL8A 2L55A 1JOQA 3K57A 4ZQ3A 1W3SA 3HOZH 3NQIA 1N36Q 4A75A 1V1QA 3CC7A 4GLVB 4JK1C 5JJLA 1LTTD 3VYRA 3SGIA 4B3SQ 1KTKA 1LT4D 2MQHA 3AFPA 4RAUC 1PH6A 1Y1VG 5DLQE 4AYBB 4HIKA 4HIOA 4ZUIA 4X64L 3QWNA 1QNUA 1GHKA 3RMHA 1NMGA 1DZ1A 4NKLA 1XMQL 1W6KA 5ELNA 1SYCA 1ML0D 2UUBL 2R92G 3A8KE 5IP9G 2B63G 1SYEA 1D8LA 4NXMQ 2RHQB 4JBJA 2K5NA 1ILPA 5I6WA 3UI2A 4CDCC 3E0JA 4H7BA 4M8AA 5FLXE 1UE1A 3PO2B 3PO3H 4A93H 2K28A 2K05A 2Z4HA 3H0GH 3ND8A 3ER0A 4IJHA 4BBRG 5E4XA 3P20A 4X66L 2K7VA 3QIAA 2UUBQ 2PYKA 4B9XA 2MNAA 1PH5A 2H1EA 1QILA 4GNXB 3RZDB 5EPJA 4YY3L 2RA4A 1TWCB 5KRUA 2K04A 4A3IG 1CFMA 1D5ZC 5ELFA 4EQPA 3C1FA 3HOVG 5K36H 2A19A 4C3JH 1HFGA 2RCFA 2A6HC 3ERQA 2YTVA 3HOXH 3S1NH 4DGZA 5M3FB 2JN4A 3IFDA 4ZCKA 2R61A 1R9TB 1K83H 1M1KC 4KMUC 3CRKC 1FNVA 1BBXC 4X66Q 1HNZL 1K8AC 2JA7H 1TS2A 3S16H 1PFNA 1KLUD 1LTSD 2QCPX 4WJ3M 1VQDA 4R4CA 2UXBQ 3A74A 2Z0SA 1PH4A 1GJXA 4GKKQ 1JB7A 3IAYA 4KI0A 3A7LA 2OT2A 3OMGA 3H94A 2SNMA 2LXKA 3S15H 2WB1B 2EYJA 1JWMD 2F4VL 5FLMH 4ME3A 1F9QA 1DOMA 2L15A 1I4GA 3I4NH 3I4MG 1HUMA 2VB3X 3MWYW 4IUQA 3NBHA 4PMCA 4IUTA 1AEXA 5DNFA 4K14A 3KYHC 5M3MH 1SEBD 3SDZA 1BBUA 3JAML 4AH6A 2PO4A 2NZHA 1PRTB 4DAYB 2KCNA 3HOYG 4HCSA 3L2PA 4OWTB 3RNUA 2B2VA 4YWLA 1YZ6A 3O13A 1TWHH 1H9SA 2ENBA 3DUZA 2M00A 3MXNA 1WTWA 3PIPA 1YJNA 4KTAA 5KNBA 3DXJC 2I46A 2WP8J 3KLWA 3UDFA 3W5OA 5ELOA 4TSSA 4DV2Q 1VQ6A 5T1IA 2MHVA 3NBIA 4U673 4KK7A 3Q22A 3BVGA 3U50C 4YCVA 2A6EC 5IWAL 2CWPA 3OIPA 3TS2A 1JQYD 4KKTA 1P16A 3L7ZC 2MGSA 1HNXL 3FPPA 3D3RA 2WV6D 1EL0A 1AE2A 2F0IA 1YHQA 4AQYL 1JB3A 1E2ZA 4X62L 4GNXA 2D0PA 4DXGA 1PRTF 1X56A 1PRTC 1FVIA 3SK8A 1XTDA 4LF4Q 3FP9A 5IWAQ 1JWSD 2ZT9C 3S1MH 1RTNA 3GTQB 1HNXQ 1MI2A 2ZJQA 2KECA 4A3DH 4IPHA 4AQYQ 3I2ZA 4JI0L 3PUZA 4C3HB 1VQAA 4XIGS 1KC8C 5C3XA 1D7QA 3H3VH 1WTXA 2A6HD 4DK0A 2KJXA 2GN5A 2QILA 1PYBA 1Q7YC 2O5IC 3MC0B 1A3UA 2NB0A 1RL2A 1ZKOA 4BBSB 4JI0Q 5M5WH 1MJEA 4A3FH 1STYA 3QB3A 1ENFA 1PDQA 1TY0A 5DEHA 3FDTA 4WRDA 2Z6BA 1F2MA 3KLSA 3E6ZX 3ONAB 1IBML 4JCVE 4IFDJ 4AYBG 2FMMA 2F0HA 1TS4A 1ESRA 4DK3C 3P1HA 1NSNS 4HSVA 2VW9A 1JT8A 4OO1H 4CGYB 1SNOA 4H13C 1ET6A 1U4PA 1JR0D 3A7AB 4XDXA 1HZ9A 5C4HA 4ABNA 1WI5A 2AQ1B 2XWJB 4BY1B 2KEEA 5EPKA 2EYPA 3CCEA 1A0IA 4A3MH 1JMCA 3S1QB 3JAME 1G2TA 3N6RA 4XT1B 5A2QL 1Y14B 3D6WA 2HUGA 1WTVA 2B8GA 2R6GA 1CT1D 4A3LH 3AMUA 4F87A 4ZYSA 3PO2G 5IGBA 4LF9L 2E76C 1V43A 4IZ8A 5C5MA 5JEAH 3D4RA 3DLLA 3M3YH 1U5KA 2VXWA 3QR8A 1XTCD 3J81L 4KY7A 1IZ6A 1HFNA 5IYBG 3VDYA 3EFXD 4DR4Q 1VF7A 4JPBW 2K5QA 1Q1BA 4LFAL 2KHIA 3K7UC 1IW7C 3RLNA 1G291 2QGQA 2LXJA 5M3FG 4ZAIA 1SYBA 3SVMA 3PF5A 2OTLA 3I7FA 2ATWA 1E24A 1K0SA 1IXRA 3BZDB 3A5UA 4IUNA 4NMZA 5JPNC 2QDBA 3BYTB 1CKMA 4LFAQ 5C0XG 1PRTD 1FD7D 3CCSA 2UUAQ 1Y1WB 2D0OA 2R93H 1ENAA 3BDCA 5D14A 2WB1G 4JI7L 1D2BA 3G7LA 4K6DA 2D2CC 4HTHA 3CCRA 1SNPA 1EY9A 1V1OA 1KRSA 3QJYA 2ZXPA 4AYBE 1I3QH 5E7NA 2MJ8A 5C4JH 1QVGA 4A3CG 1TWFB 5KGUA 3KFUA 4AIMA 1HA5A 2HIXA 1LT6D 1B9MA 1D1KA 1QOHA 4IUUA 2P5ZX 5EBDA 3C46A 2JA9A 2Y0SB 1LTLA 1K3RA 1TT2A 2JA8H 4GS3A 3S14H 1HR0Q 3J80L 1YJWA 2XN9C 4A3BH 1M4VA 2NN6G 2LY7A 1QUQA 3K5NA 3L3OC 4BA2I 1C9OA 3MHBA 2OF1A 4UPAA 5AFWA 4IOCA 1KL9A 2MFIA 2XGTA 3MXUA 2VUMB 1CZGA 5C3EH 2HCCA 1YNJC 4EQ5A 1V8QA 2RHSB 3C3LA 4K8IA 3F2CA 3PUVA 4BWGB 1U4LA 5IY0A 4OXPA 5LMNL 1XPOA 4LUOA 1RJTA 4ME5A 2EYMA 3VR4A 5CV6A 5J1ZA 3H3VC 2OQKA 5HY6A 1VQ8A 5A2QE 1VQOA 1GM5A 1TWGB 1HR0W 3BU2A 4FF1A 4TQUS 4GOPC 3KDFB 1BKBA 3R3OA 4JC0A 2E5LL 2G9DA 4NW2A 5C4ZA 5D65A 3U4ZA 3EIVA 4JI8Q 1X3GA 5I4DA 5LMNQ 4A76A 1HH2P 2TSSA 2NVYH 1RD9D 3H0GG 5LL6X 4G7ZC 5IP7G 3J81E 1DCZA 2I07B 2GVAA 3I90A 2F0FA 4C3HG 1EYGA 3OW7A 1Y1VB 3BVMA 1YHBA 4DR3Q 3EBEA 1IW7D 2WINB 2WB1E 3HGBA 5EAYA 5CGKA 4PG3A 1TWAB 1UAPA 2E5LQ 2WKDA 1EU3A 4X6AH 2FHTA 1OXXK 1E1OA 2E2IB 2PW7A 4EX5A 4BBSG 1LTID 1XWEA 2RKSA 5JVG3 1U4MA 1SJHD 1I6HH 2B39A 1VQMA 2YU9H 2WAQB 1GD7A 3W1BA 2PQEA 3DHQA 3KOJA 2KVMA 4BBRB 1TY2A 2UXCQ 1B3QA 1IBLQ 1YEZA 4C1NK 2EQSA 4KD4A 4DR2L 3OTOQ 1CKNB 2OQ0A 1BOSA 1EWIA 2NVTB 4CKEA 3NEMA 3HOUH 2R7FA 3C1EA 4BY1G 5LMUL 3T1HL 2CKZB 5M3MG 1HJPA 1CKOA 1V9PA 3OPOA 2F0QA 3GTMB 4UAIA 4RFBA 2JSOA 3KF6B 3MA2B 2QDLA 3CCJA 5IT9c 2C5CA 4L5RC 2NTSA 4DV1L 2AKWB 5GROA 4OWWB 4L5QA 1WTOA 4NDXA 3VR3A 2L1BA 4WJWA 1X54A 2DY7A 3J80E 4HJAA 1YHAA 1PH2A 2PZWA 2KCCA 2JA5H 1DM0B 1CK1A 3PQIA 2PNHA 4OIKA 1WTQA 4JV5L 4HJ8A 5ELBA 3OWFA 1X3EA 4BXXG 4G4KA 2M9VA 3NXWA 3ZJYC 1L1OA 5C4XH 5C3EB 1TS3A 4DXFA 1ZYRD 2ICEC 4DV1Q 3V2TA 3J7A5 1GXDC 1QNKA 1DYQA 3LWEA 1PXUA 2NVQH 4MIUA 1MSGA 2JA6B 3FKIB 3OWEB 1STAA 1SDFA 3S2DH 3VYTA 1HZCA 3CAMA 1OXUA 4JV5Q 4QCLA 5JJIA 2HHHL 4N8FA 3S17B 2JK8A 3CQZB 4A3JH 1Y1WG 1I4RA 1LTRD 4LNQA 1Z9FA 1S5CD 2XWBB 5HGTA 2B2TA 1N8RC 3HOWH 4QL5A 2DGYA 3WOEA 2EXDA 3FVQA 5HURA 3R2TA 1Q86C 1EFWA 1SMYC 1C7YA 1EYDA 1STNA 1V1PA 3TEHB 3VYSA 1HUNA 4JOIA 5EJWA 2HHHQ 3A8IE 5LL6S 4DKAC 2HQEA 4HJ9A 4DV3L 2AHOB 1GHJA 3MFGA 3SHLA 2L4NA 3S2HB 1XNRL 4MN3A 1I50H 3F2DA 4P71A 3D31A 3W1GA 1B7YB 2K50A 1X3QA 2Y0SG 1FYCA 3X3MA 3SEBA 3KJOA 2FJ2A 1SROA 4DR5L 4A3FG 1ET9A 4RHRA 4ZKBB 1HCZA 3R8BA 4L8JA 1LTAD 1Z47A 1RDPD 4GZYC 2JEBI 1AW7A 2QEJC 3FEWX 5CR3A 2M2LA 1Q12A 3LX0A 4NXNQ 1WCMH 2NZ1D 3GDEA 2VUMG 2F0WA 1KAWA 3GTPH 4GLAC 2F03A 2F0PA 1D6EC 5HGQA 2B2UC 1EU4A 3FMCA 4DUYL 4LF5L 2UUCQ 3PUWA 2E2JB 4OO1G 4ILWA 1X32A 1Y69U 1WD1A 1RODA 4LFCL 1H9KA 2Z6KC 2CCZA 1SR3A 4X3SA 1J5EL 1U4RA 2JYOA 2TMPA 4IPDA 4Q5VA 1EY5A 5ISRA 3G6EA 3HFZB 4LF8L 4HSPA 2ZXRA 5FKAC 4WJ4A 1HHVA 4A3GB 4KHVA 1FJGL 3U9SA 1W2BA 1ESFA 5IE8A 4H44C 4C3IB 2AWNA 5KNCA 2A73B 4OWXB 1ASZA 1WD0A 1O7IA 2RDFA 2AUJD 2EIFA 4DK1A 4V190 3K58A 1CHPD 1J5EQ 4G7HC 1S5ED 3VR2A 3DMUA 3TDQA 1SXTA 1Z6HA 2J0TD 1K0RA 2SDFA 3GTKB 1S5DD 2BA1A 4DR7Q 2F0EA 1IKLA 1LTBD 4IFDG 3RN2A 3PF4A 1XNQL 2ALYB 1AH9A 1YNNC 2K5HA 3OOCA 3ICEA 1JOKA 5IGEA 2Q8RE 4H0LC 1I4XA 3GQBA 4X65L 3PIOA 2DUDA 3LGJA 1VQGA 1STEA 1TVXA 2WAQG 2K14A 4FYDA 2PQAA 2ZTDA 4X64Q 2Y0SE 3HZXA 1MJCA 3NWSA 3PIP3 2EJGC 2KOLA 5JAVA 4O0AA 3GTOH 1GOZA 4R4TA 4HN7A 1XMQQ 1SMYD 1UE6A 4CKBA 5M5XH 4K5VA 3A54A 2XRQD 3KJPA 3Q24A 3GTLH 2BDNA 5IYDH 1KDCA 3I91A 3F1ZA 2K6AA 1AP0A 1Q90A 4HJ7A 1JC7A 4KD3A 4NP5A 3H15A 3GD7A 3MTSA 4R8IA 4DV0L 3L0OA 2C9OA 4YY3Q 1PHJA 3CMEA 2EDGA 5KYLA 1C0AA 2EOTA 4A3BG 2E2HB 3T4AC 1B9NA 1BUVT 3CU7A 1H9MA 3QG1A 4LF6L 5GAEC 1SNMA 4KN7C 4QB4A 2O2LD 5L37A 2ZM6L 5DAUA 4QF4A 3Q0AA 5GAGC 1L0XB 1NCVA 5FO9B 1HNZQ 1CI3M 5C3EG 4A3KB 3OYYA 3I56A 4QQBX 4XT3B 1SFOH 4DV0Q 1WTPA 3M4OH 1GUGA 4A4IA 2Z9HA 1YJ9A 3JAMc 5AJ3L 4OIJA 4XQJA 2JA6G 1QWYA 3FKIG 4TVAB 1BBWA 3CCUA 4LF6Q 3BVZA 4JI6L 4JI3L 2F3IA 4IN3A 2IX1A 2F4VQ 1N34L 3KBGA 3VR6A 1Y8NB 1LM0A 3CD6A 1GKHA 2WAQE 1VQBA 3D4DA 1Q1EA 4FNFA 3AB9A 4K8JA 3CCLA 3HOZB 1G6PA 2RSOA 3HEJA 2ZTCA 2EY5A 4JI3Q 4LWCA 4RH6A 1JOOA 4RMFA 2HCIA 3DM3A 2XNAC 4DNTB 3S1RH 1Q46A 4BY7H 2L9HA 2PNRC 1YNND 1FR3A 2CVRA 4FF2A 4DV5L 2AUKA 2KUMA 2NVXH 2F0SA 3C2PA 1Y8OB 1VF5C 1G8ZD 4GN5A 3TQYA 3MXPA 4B3RL 2K5VA 2RCNA 1DOLA 1KHIA 1F9RA 5EGTA 4KN4C 1TS5A 1PZID 4CJ0B 2QKIC 3MEHA 1HRJA 1LACA 1VQHA 3G6JB 1MGSA 3PO3B 4A93B 3EVQA 2A68C 1HA6A 3H0GB 1NAPA 3CW2C 1NBWA 1T9HA 4DNRB 1VMCA 4X62Q 3M7NA 3TZDA 1IYVA 1QZHA 3I72A 4CKCA 4RGOS 2LSSA 1KAAA 4P74A 5I2YA 4R9WA 1MD2D 3VA5A 4C3JB 4A3GG 3EN2A 3S1NB 3HOXB 4G57A 1VQ9A 3E9HA 4C3IG 1K83B 1OO9B 4KJOA 5JEAJ 1CA6A 1BDOA 3MVVA 4M1UB 1VQNA 2JA7B 3K7AH 1PTOH 4DFAA 4L5SA 3S16B 1EY8A 1TU2B 1JJCB 3GO5A 3RD4A 1VQCA 4FXDA 2JA5G 2MP1A 1JCKB 1EQTA 4XXEA 1PLFA 4DAYA 4B3ML 4B3TL 4J8QA 3RR5A 3T53B 3R93A 2IX0A 1G91A 1YVCA 2BH8A 2E8GA 2GVBA 1PH1A 3PUYA 3S15B 5CC4A 3QOLA 4DAVA 1JORA 4I7AA 2RVLA 3I4NB 3M4OB 5H1SE 1SN8A 5I9PA 1N32L 2Z1CA 3CXCA 2JP1A 5M3MB 3G48A 3UE0A 1IBMQ 2R7ZH 1TR5A 4B3MQ 4X3UA 3GTGH 3A5ZB 5KYIA 1FNUA 1SYDA 3I70A 2D5DA 3CRLC 3J81c 1TWHB 3GTJH 5TSSA 4L63B 3UDGA 2E2DC 3E9IA 1Q81C 3V05A 4K2LA 2KHJA 1PFBA 1MHWC 3E3XA 2V4DA 1ZXTA 1Q8KA 3TP6A 1X3PA 2F3WA 2A6ED 5ELDA 1VQ4A 3PUXA 4LF9Q 1RKNA 5IYCG 4WFN3 4JI1L 4LK1C 4PZ7A 3HKZB 2RDGA 1VDZA 5EKKA 4WORA 3J81j 3K5MA 2K32A 1GUSA 2B8FA 2O5JC 2O4XA 4NB3A 2D62A 4DK6C 3NE5B 4QJFA 3RLFA 4RGTA 3OSOA 4QGUA 1C4QA 4JI1Q 5EBCA 3S1MB 4HAEA 2A68D 1RCVD 2R92H 3NP8A 4A3KG 5IP9H 2B63H 4A3DB 3T1YL 1BO0A 3UDXA 1GUTA 1GO3E 2F0DA 3KF8B 2FXQA 3FPUB 4BA1I 1VQKA 1G51A 1F2YA 3CHBD 2ZJPA 1U0LA 3M4PA 2L0CA 4RCNA 4IO9A 1S40A 4JBKA 3IRBA 1D5MC 1P8LA 3DWAA 2B2WC 3EQLC 4GOPB 3U58A 4JI7Q 4DA2A 4TRDA 1SYFA 1E2VA 3CF5A 1SE3A 1EQQA 3TP8A 3J80c 3DWQA 1EUJA 5M5WB 1D1IA 4A3FB 3K7AB 3ULPA 3HOVH 5BN4A 1LO5D 3HOZG 1S3OA 1VQEA 1XPUA 1ICFB 1Q8IA 3EROA 2DN8A 4K2KA 4YHHL 3S9WA 4DUZL 3KLRA 3K5OA 2F3VA 2YTXA 1II3A 3DM1A 2JQOA 4NPSA 1KD1C 4E6IA 2H4OA 1KNEA 2RDHA 3K6OA 1A6XA 3NWTA 1EIGA 1CQVA 2EY1A 3TP5A 2OWOA 1F77A 4J6HA 4A3MB 2G5DA 2QW7A 1XMOL 4N8X1 5EPLA 4K6LA 4JW0A 4FXGC 2NTTA 5CV9A 4F7XA 2QA4A 2YV5A 2F0TA 3I4MH 2AQ2B 3RN5A 1A63A 1WVLA 4A3EH 3PO3G 4A93G 1ICWA 2AWOA 2OXPA 3M3YB 1PTOC 1I5FA 1RIPA 2PI2E 1SYGA 1JWUD 2CFMA 4DV7L 3HOYH 1QB5D 2CQAA 3IKJA 1RF2D 3Q8DA 4O42A 1STGA 5K36G 4C3JG 5DM73 2VZAA 4O2DA 5F2DA 3HOXG 1BCPB 4QY7A 2VQFL 2R7DA 1FGUA 1PMRA 2JA7G 2F0GA 4C2MH 3NENA 1J8IA 4KY6A 4DV7Q 4RGNA 5M5YH 5LMNW 1EYCA 1UWVA 1F2ZA 2NYZD 4I65A 1F9PA 3HRZC 2JEAI 3W3AA 3T56B 2F0LA 3CC2A 1SBBB 1CUKA 3FRPB 1HNWL 2VQFQ 2R93B 3NK9A 3F2UA 1FL0A 5COYA 5FLMG 1IKMA 4KKUA 2PW5A 4S3SA 2F4IA 2NWGA 3M7GA 3CC4A 3I4NG 1I3QB 1EWCA 5C4JB 2PZUA 1QG7A 1BCPF 2PCFB 1BCPC 4KY5A 4UY8C 1HNWQ 4PMBA 3RZOH 4DR2Q 4H02A 4HEDA 3HG9A 2JA8B 1SLJA 2NBFA 2IHEA 4RG1A 3S14B 4LF7L 5LMUQ 3T1HQ 4ODGA 2E75C 1TKWB 4A3BB 1T5XD 2LMCB 4ZK9B 4L5TA 3TMEA 4OELB 1JJ2A 4XTCS 4DR6L 1YIJA 4YCUA 3CMAA 4XQQA 3KDFA 3UDIA 1BR9A 2UU9L 1YNJD 2UXDL 4HIMA 1IYUA 1H9JA 4RHSA 4B08A 2JXMB 3QOJA 3HKZG 1AN8A 4LF7Q 1PFMA 4HJ5A 3SXHA 1B4OA 4EVOA 2F1MA 1DOKA 3OHXC 5IODA 3BYYB 3IFTA 2DJGC 4I7ZC 4IURA 5FLXc 1J6QA 2UU9Q 2K4KA 4MHEA 1BQQT 1IL8A 3AU7A 3HP3A 4CDDC 2IW3A 4QMGA 2K5WA 1CSQA 4A3DG 1STBA 2NVYB 4DF7A 1PH3A 1S5FD 2Q8IB 1KXLA 2ZTEA 5J3BA 4IOAA 4ZUJA 2Q8TA 1I94L 3BDLA 1VQFA 4PZ6A 1EIYB 3URYA 1EOVA 3K81C 4DR1L 3PO2H 4DV6L 4LFBL 3MXGA 2EJFC 2F0JA 2K52A 2BCOA 3G71A 2SEBD 1E22A 1S5BD 3PIO3 2RSNA 1SE2A 3JAMi 4K0KL 1N33L 1O7LA 3RZDH 5IYBH 3WWVA 1CKNA 1TWCH 4P75A 5BN3A 5CMDA 1PH9A 1I94Q 3SK6A 4C2MB 1T5EA 1I6HB 4RA8A 5M5YB 2IX3A 4OHJA 2YU9B 2XRSD 4DV3Q 5M3FH 2K75A 4KHZA 1R9TH 2B2YC 2NZOA 3BS1A 1UE5A 5FOBB 1XNRQ 3KF6A 4GN4B 4UP7A 2KENA 5J39A 1RHPA 3M9BA 1LV9A 1N33Q 1EY4A 2LS01 2B29A 5CV4A 1VQIA 5C0XH 4DR5Q 4PMWA 1K8MA 3UE1A 4R4OA 2ZJRA 3HOUB 5ELEA 1UE7A 4V0BA 1EFID 1ONLA 2XIWA
chains in the Genus database with same CATH topology
1BCPD 1B3AA 2F0NA 4RWSC 1O78A 2SOBA 3KLSX 1L0YB 2IWHA 3NUCA 5DM63 5JEAG 3EA6A 4F8MA 1U9RA 3I8ZA 3MFYA 1B50A 2K33A 2R3ZA 2JA5B 2IJ0A 3EJIA 2K5DA 4C56C 3M85A 4CJ2C 2BDOA 1A3VA 3W2DA 5C4XB 2B2UA 5KNDA 2NN6H 5E1FA 3TSSA 2NVQB 1OXTA 3S2DB 4IFDI 3PV0A 5FK9C 1F9SA 3U9OA 1H9SB 2AQ3B 4A3JB 1B2TA 1HQRD 3HS0C 2KHSA 3L9AX 1SNQA 1H9RA 2MUYA 3HOWB 1XXGA 3TN2A 1EOTA 5JJZA 5G3LF 2OEOA 1R4QB 2X69A 4CBVA 3BG3A 3NQTA 1UEAB 2SNSA 1EQVA 2K03A 1I50B 1LT5D 1O7ZA 3I4LA 2BOSA 4R8NA 1OXSC 1SNCA 5K5PA 2B2VC 2ZXOA 5I2XA 4IUPA 4HCEA 3T13A 2KEDA 3MAQA 1WCMB 2K01A 3GTPB 5CYUA 4IQZA 1GUNA 2L11A 4QIWB 3K5LA 1KDAA 4DU9A 3NPPA 5ELCA 2DNCA 2X6LA 4PNYA 3SK4A 1FGBD 2EY2A 1LT3D 1DD2A 2N88A 4FF3A 3D8GA 1QCBD 1TQOA 2HDLA 2RBMA 5A35A 4X3TA 4ULLA 2GA4B 1KLGD 2LFNA 3ND9A 1PZKD 4FP5D 5C5LA 3SE0A 1EY6A 2VB2X 1CHQD 1SSOA 3LNNA 2KQ3A 1UNSA 4LJZC 2K1BA 5J22A 4N9PA 4XYQA 5CV7A 4C1NI 2WIIB 3R2IA 1VMPA 4ID6A 3GTOB 3DWPA 3IL8A 1AFPA 2L12A 1VCIA 1M8AA 1EIHA 5M5XB 3GV3A 4LMQD 1QJOA 1PYWD 5G3LD 3GTLB 1B53A 3H6MA 2FFKB 4XYOA 1E0BA 2A74C 4EQOA 1B1ZA 2X6GA 4FF4A 1A3TA 4DAPA 5C44B 2EYLA 4L6TB 2EPBA 5JVH3 4OGQC 1BF4A 5LHY1 3LWUA 1GUWA 1B44D 2RQXA 4Q0FA 1O7YA 3NTIA 4UDUC 4FXKC 4HMJA 1EWHA 1SFOB 4CJ1B 2F0VA 1F2LA 1Z7TA 1ENCA 1RTOA 3BDOA 1TIID 2DY8A 1AZPA 1C8CA 2BE5C 4IUVA 1LTGD 3T16A 5EKLA 2BA0A 2J7ZA 5D3IB 2Z4IA 2A69C 3T51B 2EJMA 5C3WA 3P75A 5C6AA 1MSHA 2N55A 1K8OA 1Q3LA 3TZUA 1A2UA 2Z8LA 3OMCA 3VR5A 3P7JA 1OXVA 2HDMA 1A15A 5D3DA 4KV6A 3CKIB 3S1RB 3K0YA 4BY7B 2LKVA 2ID0A 1SE4A 2EYFA 3NTHA 2NVXB 1WTRA 2EZVA 3H09A 1EYAA 4IALA 1Y8PB 1MBYA 4IFDH 2WACA 5CORA 4RGMA 1EY7A 2EY6A 4PQXA 4EQNA 1EY0A 1S4ZA 5FO8B 2DNEA 5C0XI 1EZ6A 1BXTA 1CM9A 1ONLA 1I6VC 4U68A 2EYHA 4P2CB 2CW0C 4EGVA 1CZWA 4JBWA 1SAPA 3I3CA 1SNDA 1CTMA 1XYIA 5EQ0A 4N9TA 5T1GA 3N52A 2D9UA 5IOCA 3NTKA 1A2TA 1R4PB 1PTOB 4O1NA 4LAAA 4ZKCB 3PMFA 4Y7NB 3J7YW 4DN4M 2L5TA 1QE6A 1I4QA 1KDBA 3I73A 1JICA 1STHA 2G9HD 3KBXA 1HXYD 1EEFD 2FMCA 2NN6I 2EE1A 2A5HA 3TP7A 2NUCA 2J4XA 4OL7A 2XVSA 5CBAE 2EXZA 3OIQA 2BE5D 2PPBC 2R7ZB 1NR2A 1FNWA 5IGCA 3GTGB 2B2WA 1ZYRC 2A69D 5I6YA 3KUPA 1SJED 1PTOF 3GTJB 5IGGA 3Q23A 1W6JA 1DXMA 4HMIA 4CHTB 3TBIB 4J1MA 4RKBA 1HTLD 3K59A 3D6CA 4B9WA 5IIFA 3V96A 1EEID 3D4WA 2CHBD 1UUPA 1J9OA 3NHHA 5FO7B 4QUFA 1C48A 2XSCA 1KABA 1KNAA 1XX8A 3KF8A 5BN5A 3DEPA 5CBEE 3ITPA 1D5XC 1JE4A 4G7OC 4Z9CB 1GUOA 3SK5A 5EKIA 1NR4A 3M4YA 2R92B 3RUZA 2B63B 1V1PB 3KK7A 5I9OA 2EVBA 1G6ZA 4PV1C 2CW0D 2PZTA 1CQFA 3GP7A 3VA7A 1I4HA 3X3NA 1HTPA 2FINB 5E3FA 5KEEA 2F0KA 4A3IB 1LABA 2ICIA 3HOVB 5IGDA 3GV6A 1HPCA 4K5XA 4XQNA 2F0OA 3A56A 5CV5A 2B2TC 5IT9L 1ZEQX 1NUCA 1LLRD 4K5WA 4TKOB 5NUCA 3J7AF 4HR7B 2WKCA 1HQMC 1BNZA 4RCOA 3H91A 3J7AV 1DONA 3Q6SA 2MPMA 3I4MB 5M9OA 4A3EB 1PTOD 3VYUA 2PMZB 2JE6I 2KA7A 5C0XJ 1CA5A 2YYZA 5KIXA 4ZRZA 3HOYB 3WDNA 3MZ5A 1I4PA 5FLXL 5E4WC 3QO2A 4YIJA 2E74C 4QUCA 2IPKD 3DEOA 1ILQA 2VNUD 4RKLA 2EYOA 3A55A 3E5SA 4F88A 1DJRD 2QF7A 2F0UA 3SR1A 5JOBA 1E2WA 1O80A 4KKSA 4X3KA 2IT1A 4BS9A 4FVMA 1AZQA 4KJNA 5CV8A 4OO1I 3ZYYX 3RZOB 1IHZA 5JPMC 4FO2A 3NSWA 3A8JE 5IGFA 1G2SA 1EZ8A 2B2YA 1PZJD 2F0MA 3WOFA 5IT9E 2IL8A 2L55A 1JOQA 3K57A 4ZQ3A 3NQIA 4JK1C 1LTTD 3VYRA 1KTKA 1LT4D 4RAUC 4AYBB 4ZUIA 3QWNA 1QNUA 1GHKA 3RMHA 1DZ1A 4NKLA 1W6KA 1SYCA 1ML0D 3A8KE 1SYEA 1ILPA 5I6WA 3UI2A 3E0JA 4H7BA 4M8AA 5FLXE 3PO2B 2K28A 2K05A 2Z4HA 3ND8A 5E4XA 3P20A 2K7VA 3QIAA 2PYKA 4B9XA 2H1EA 1QILA 3RZDB 5EPJA 2RA4A 1TWCB 5KRUA 2K04A 1CFMA 1D5ZC 5ELFA 4EQPA 3C1FA 5K36H 1HFGA 2A6HC 3ERQA 4DGZA 5M3FB 3IFDA 1R9TB 2R61A 4KMUC 3CRKC 1FNVA 1BBXC 1TS2A 1PFNA 1KLUD 1LTSD 2QCPX 1GJXA 3IAYA 4KI0A 3A7LA 2OT2A 3OMGA 3H94A 2SNMA 2WB1B 2EYJA 1JWMD 1F9QA 1DOMA 1I4GA 1HUMA 2VB3X 3MWYW 4IUQA 3NBHA 4PMCA 4IUTA 1AEXA 5DNFA 4K14A 1SEBD 3SDZA 3JAML 2PO4A 1PRTB 2KCNA 4HCSA 2B2VA 3O13A 1H9SA 2ENBA 3DUZA 2M00A 3MXNA 1WTWA 4KTAA 5KNBA 3DXJC 2I46A 2WP8J 4TSSA 5T1IA 2MHVA 3NBIA 4U673 4KK7A 3Q22A 3BVGA 2A6EC 3OIPA 1JQYD 4KKTA 3L7ZC 2MGSA 3FPPA 3D3RA 2WV6D 1EL0A 2F0IA 1JB3A 1E2ZA 4DXGA 1PRTF 1PRTC 3SK8A 1JWSD 2ZT9C 1RTNA 3GTQB 1MI2A 2KECA 3PUZA 4C3HB 4XIGS 5C3XA 1WTXA 2A6HD 4DK0A 2KJXA 2QILA 2O5IC 3MC0B 1A3UA 2NB0A 1ZKOA 4BBSB 1STYA 3QB3A 5DEHA 1ENFA 1PDQA 1TY0A 3FDTA 4WRDA 1F2MA 3KLSA 3E6ZX 3ONAB 4IFDJ 2FMMA 2F0HA 1TS4A 1ESRA 3P1HA 1NSNS 4HSVA 4OO1H 4CGYB 1SNOA 4H13C 1ET6A 1U4PA 1JR0D 3A7AB 4XDXA 5C4HA 4ABNA 2AQ1B 2XWJB 4BY1B 2KEEA 5EPKA 2EYPA 3S1QB 3JAME 1G2TA 3N6RA 4XT1B 5A2QL 3D6WA 2HUGA 1WTVA 2B8GA 2R6GA 1CT1D 3AMUA 4F87A 4ZYSA 5IGBA 2E76C 1V43A 4IZ8A 5C5MA 5JEAH 3D4RA 2VXWA 1XTCD 3J81L 4KY7A 1HFNA 3EFXD 1VF7A 2K5QA 1Q1BA 1IW7C 1G291 4ZAIA 1SYBA 3SVMA 3BZDB 4IUNA 4NMZA 5JPNC 2QDBA 3BYTB 5C0XG 1PRTD 1FD7D 1Y1WB 1ENAA 3BDCA 5D14A 1D2BA 3G7LA 4K6DA 2D2CC 4HTHA 1SNPA 1EY9A 1V1OA 3QJYA 2ZXPA 2MJ8A 1TWFB 5KGUA 1HA5A 1LT6D 1B9MA 1D1KA 1QOHA 4IUUA 5EBDA 3C46A 2Y0SB 1TT2A 3J80L 2XN9C 1M4VA 2NN6G 2LY7A 3K5NA 3L3OC 4BA2I 3MHBA 2OF1A 5AFWA 3MXUA 2VUMB 1CZGA 2HCCA 1YNJC 1V8QA 3C3LA 4K8IA 3PUVA 4BWGB 1U4LA 1RJTA 4ME5A 2EYMA 3VR4A 5CV6A 5J1ZA 3H3VC 5A2QE 1TWGB 4FF1A 4TQUS 3R3OA 2G9DA 4NW2A 5C4ZA 5D65A 5I4DA 2TSSA 1RD9D 5LL6X 4G7ZC 3J81E 1DCZA 2I07B 3I90A 2F0FA 4C3HG 3OW7A 1Y1VB 3BVMA 1IW7D 2WINB 3HGBA 5CGKA 1TWAB 1UAPA 2WKDA 1EU3A 2FHTA 1OXXK 2E2IB 2PW7A 1LTID 1XWEA 2RKSA 5JVG3 1U4MA 1SJHD 2B39A 2WAQB 2PQEA 3DHQA 2KVMA 4BBRB 1TY2A 4C1NK 4KD4A 1BOSA 2NVTB 4CKEA 3C1EA 3OPOA 2F0QA 3GTMB 4UAIA 4RFBA 2JSOA 3MA2B 2C5CA 2NTSA 1WTOA 4NDXA 3VR3A 2L1BA 4WJWA 2DY7A 3J80E 2PZWA 2KCCA 1DM0B 1CK1A 4OIKA 1WTQA 5ELBA 3OWFA 4G4KA 2M9VA 3NXWA 5C3EB 1TS3A 4DXFA 1ZYRD 2ICEC 3V2TA 1GXDC 1QNKA 1DYQA 3LWEA 1PXUA 4MIUA 1MSGA 2JA6B 3FKIB 3OWEB 1STAA 1SDFA 3VYTA 1OXUA 4QCLA 3S17B 3CQZB 1I4RA 1LTRD 2XWBB 1S5CD 5HGTA 2B2TA 3WOEA 3FVQA 5HURA 3R2TA 1SMYC 1EYDA 1STNA 1V1PA 3VYSA 1HUNA 5EJWA 3A8IE 5LL6S 2HQEA 1GHJA 3MFGA 3SHLA 2L4NA 3S2HB 4MN3A 3D31A 1X3QA 1FYCA 3X3MA 3SEBA 2FJ2A 1ET9A 4RHRA 4ZKBB 1HCZA 3R8BA 4L8JA 1LTAD 1Z47A 1RDPD 4GZYC 2JEBI 1AW7A 2QEJC 3FEWX 5CR3A 2M2LA 1Q12A 3LX0A 2NZ1D 2F0WA 2F03A 2F0PA 1D6EC 2B2UC 1EU4A 3FMCA 3PUWA 2E2JB 4OO1G 4ILWA 1X32A 1Y69U 1WD1A 1RODA 1H9KA 4X3SA 1U4RA 2JYOA 2TMPA 4Q5VA 1EY5A 5ISRA 4HSPA 2ZXRA 5FKAC 1HHVA 4A3GB 4KHVA 3U9SA 1ESFA 4H44C 4C3IB 2AWNA 5KNCA 2A73B 1WD0A 2RDFA 2AUJD 4DK1A 4V190 3K58A 1CHPD 4G7HC 1S5ED 3VR2A 3DMUA 3TDQA 1SXTA 1Z6HA 2J0TD 2SDFA 3GTKB 1S5DD 2BA1A 2F0EA 1IKLA 1LTBD 4IFDG 1YNNC 3OOCA 1JOKA 5IGEA 2Q8RE 4H0LC 1I4XA 3GQBA 1STEA 1TVXA 4FYDA 3HZXA 3NWSA 3PIP3 2EJGC 2KOLA 5JAVA 1GOZA 4HN7A 1SMYD 4CKBA 4K5VA 3A54A 2XRQD 3Q24A 2BDNA 1KDCA 3I91A 2K6AA 1AP0A 1Q90A 1JC7A 4KD3A 4NP5A 3GD7A 3MTSA 4R8IA 2C9OA 2EDGA 5KYLA 2EOTA 2E2HB 3T4AC 1B9NA 1BUVT 3CU7A 1H9MA 3QG1A 1SNMA 4KN7C 4QB4A 2O2LD 5DAUA 4QF4A 3Q0AA 1L0XB 1NCVA 5FO9B 1CI3M 4A3KB 4XT3B 1WTPA 1GUGA 4OIJA 4XQJA 1QWYA 3BVZA 4IN3A 2IX1A 3KBGA 3VR6A 1Y8NB 3D4DA 1Q1EA 4FNFA 3AB9A 4K8JA 3HOZB 2RSOA 3HEJA 2EY5A 4RH6A 1JOOA 2HCIA 4DNTB 2XNAC 2L9HA 2PNRC 1YNND 1FR3A 2CVRA 4FF2A 2AUKA 2KUMA 2F0SA 3C2PA 1Y8OB 1VF5C 1G8ZD 3MXPA 1DOLA 1F9RA 5EGTA 4KN4C 1TS5A 1PZID 4CJ0B 2QKIC 3MEHA 1HRJA 1LACA 3G6JB 1MGSA 3PO3B 4A93B 3EVQA 2A68C 1HA6A 3H0GB 1NAPA 4DNRB 1VMCA 3M7NA 3TZDA 1IYVA 3I72A 4CKCA 4RGOS 1KAAA 5I2YA 4R9WA 1MD2D 3VA5A 4C3JB 3S1NB 3HOXB 4G57A 4C3IG 1K83B 1OO9B 4KJOA 5JEAJ 1CA6A 1BDOA 3MVVA 4M1UB 2JA7B 1PTOH 4DFAA 3S16B 1EY8A 1TU2B 3GO5A 3RD4A 4FXDA 2MP1A 1JCKB 1EQTA 4XXEA 1PLFA 4DAYA 4J8QA 3T53B 3R93A 2IX0A 1G91A 3PUYA 3S15B 5CC4A 3QOLA 4DAVA 1JORA 2RVLA 3I4NB 3M4OB 5I9PA 2Z1CA 2JP1A 5M3MB 1TR5A 4X3UA 5KYIA 1FNUA 1SYDA 3I70A 2D5DA 3CRLC 1TWHB 5TSSA 4L63B 2E2DC 3V05A 4K2LA 1PFBA 2V4DA 1ZXTA 3TP6A 1X3PA 2F3WA 2A6ED 5ELDA 3PUXA 1RKNA 4WFN3 4LK1C 3HKZB 2RDGA 1VDZA 5EKKA 4WORA 3K5MA 2K32A 1GUSA 2B8FA 2O5JC 2O4XA 2D62A 3NE5B 3RLFA 4RGTA 3OSOA 1C4QA 5EBCA 3S1MB 4HAEA 2A68D 1RCVD 3NP8A 4A3DB 1BO0A 1GUTA 2F0DA 3FPUB 4BA1I 3CHBD 1F2YA 2L0CA 4RCNA 1D5MC 3DWAA 2B2WC 3EQLC 4DA2A 4TRDA 1SYFA 1E2VA 1SE3A 3TP8A 3DWQA 5M5WB 1D1IA 4A3FB 3K7AB 5BN4A 1LO5D 1Q8IA 3EROA 2DN8A 4K2KA 3S9WA 3KLRA 3K5OA 2F3VA 1II3A 3DM1A 4E6IA 2H4OA 1KNEA 2RDHA 3K6OA 1A6XA 3NWTA 1EIGA 1CQVA 2EY1A 3TP5A 1F77A 4J6HA 4A3MB 5EPLA 4K6LA 4FXGC 2NTTA 5CV9A 4F7XA 2F0TA 2AQ2B 1WVLA 1ICWA 2AWOA 2OXPA 3M3YB 1PTOC 1SYGA 1JWUD 1QB5D 2CQAA 3IKJA 1RF2D 4O42A 1STGA 5K36G 4C3JG 5DM73 5F2DA 1BCPB 1PMRA 2F0GA 1J8IA 4KY6A 4RGNA 1EYCA 1F2ZA 2NYZD 4I65A 1F9PA 3HRZC 2JEAI 3W3AA 3T56B 2F0LA 1SBBB 3FRPB 2R93B 3NK9A 3F2UA 5COYA 1IKMA 4KKUA 2PW5A 4S3SA 2F4IA 2NWGA 3M7GA 1I3QB 1EWCA 5C4JB 2PZUA 1QG7A 1BCPF 2PCFB 1BCPC 4KY5A 4PMBA 4HEDA 3HG9A 2JA8B 2NBFA 3S14B 4ODGA 2E75C 1TKWB 4A3BB 1T5XD 2LMCB 4ZK9B 3TMEA 4XTCS 4XQQA 1BR9A 1YNJD 1IYUA 1H9JA 4RHSA 4B08A 2JXMB 3QOJA 1AN8A 1PFMA 3SXHA 1B4OA 4EVOA 2F1MA 1DOKA 3OHXC 5IODA 3BYYB 3IFTA 4I7ZC 4IURA 4MHEA 1BQQT 1IL8A 3AU7A 3HP3A 2IW3A 4QMGA 2K5WA 1STBA 2NVYB 4DF7A 1S5FD 2Q8IB 4ZUJA 2Q8TA 3BDLA 3URYA 3MXGA 2EJFC 2F0JA 2BCOA 2SEBD 1S5BD 3PIO3 2RSNA 1SE2A 1O7LA 5BN3A 5CMDA 3SK6A 4C2MB 1T5EA 1I6HB 4RA8A 5M5YB 2IX3A 4OHJA 2YU9B 2XRSD 4KHZA 2B2YC 3BS1A 5FOBB 5J39A 1RHPA 1LV9A 1EY4A 2LS01 5CV4A 5C0XH 4PMWA 1K8MA 3HOUB 5ELEA 4V0BA 1EFID 4ZLTF 2XIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K28 A;  2K05 A;  1NR4 A;  5EKI A;  2EPB A;  1B3A A;  3DEO A;  1ILQ A;  4RWS C;  5E4X A;  1SAP A;  4X3U A;  2L11 A;  4ZAI A;  4ZK9 B;  3I3C A;  3DM1 A;  2RSO A;  3SVM A;  3I90 A;  1BF4 A;  2H1E A;  2Q8R E;  1XYI A;  1GUW A;  4QUC A;  1KNE A;  5EPJ A;  5EQ0 A;  2RA4 A;  1G6Z A;  5T1G A;  2K04 A;  3N52 A;  1O7Y A;  2D9U A;  1EIG A;  1RTN A;  1TVX A;  2HCI A;  1MI2 A;  2B2T A;  1HFG A;  2X6L A;  2KEC A;  3I8Z A;  1B50 A;  4ZKC B;  2L9H A;  2FHT A;  5EPL A;  1PFB A;  2CVR A;  4CJ1 B;  2KUM A;  2R3Z A;  1O80 A;  1F2L A;  3IFD A;  1ZXT A;  4DN4 M;  1QE6 A;  1HUN A;  4X3K A;  1RTO A;  1PFM A;  2N88 A;  1X3P A;  2FIN B;  2KOL A;  1BBX C;  1B4O A;  5EJW A;  1AZQ A;  2DY8 A;  1WVL A;  1AZP A;  1C8C A;  1ICW A;  1U4M A;  1DOK A;  5D14 A;  4IUV A;  1WTX A;  4CJ2 C;  2HDL A;  1JIC A;  1PFN A;  3G7L A;  1DOL A;  3GV6 A;  4IUR A;  1F9R A;  2L4N A;  2J7Z A;  4X3T A;  3KBX A;  4MHE A;  2B2U A;  4MN3 A;  1IL8 A;  2EE1 A;  3HP3 A;  2BDN A;  4CJ0 B;  1X3Q A;  5CBA E;  2JP1 A;  1HRJ A;  2B2T C;  3I91 A;  2MJ8 A;  4O42 A;  1MSH A;  2N55 A;  2FJ2 A;  1MGS A;  2KVM A;  1SSO A;  1Q3L A;  1HA6 A;  1NAP A;  4IUU A;  4ZKB B;  1NR2 A;  1F9S A;  1AP0 A;  1VMC A;  1PDQ A;  2B2W A;  3TZD A;  3FDT A;  1F9Q A;  2Q8T A;  2K1B A;  1DOM A;  3KUP A;  2M2L A;  3P7J A;  1B2T A;  3MTS A;  1HUM A;  1G2S A;  2HDM A;  3MWY W;  3ONA B;  2B2Y A;  1A15 A;  4IUT A;  4IUQ A;  4R8I A;  5DNF A;  2NZ1 D;  1J8I A;  2FMM A;  4HAE A;  4R9W A;  2IL8 A;  1ESR A;  2B2U C;  1BNZ A;  4HSV A;  3TN2 A;  4UAI A;  2NYZ D;  2EOT A;  1BO0 A;  2RSN A;  3H91 A;  1DON A;  3Q6S A;  1EOT A;  1X32 A;  1F9P A;  1U4P A;  4HCS A;  2MPM A;  1ROD A;  2B2V A;  3FPU B;  4XDX A;  5JJZ A;  1WTR A;  1WD1 A;  5AFW A;  4RAU C;  1CA6 A;  1VMP A;  4X3S A;  1U4R A;  2JYO A;  5CMD A;  2X69 A;  2KEE A;  5EPK A;  1WTW A;  1NCV A;  3F2U A;  3IL8 A;  1WTO A;  2HCC A;  2L1B A;  1HHV A;  2B2W C;  4RA8 A;  2L12 A;  5COY A;  1IKM A;  1G2T A;  4XT1 B;  2DY7 A;  4XT3 B;  1CA5 A;  3D6W A;  1WTP A;  2HUG A;  1M8A A;  5COR A;  1EIH A;  1U4L A;  2K03 A;  1WTV A;  2B2Y C;  2NWG A;  3GV3 A;  2MP1 A;  1J9O A;  4OIK A;  1DZ1 A;  1WTQ A;  1EQT A;  4LMQ D;  4QUF A;  4OIJ A;  5T1I A;  1B53 A;  1KNA A;  1PLF A;  1RJT A;  1O7Z A;  1XX8 A;  1WD0 A;  2FFK B;  3R93 A;  1RHP A;  1ML0 D;  1LV9 A;  1G91 A;  1QG7 A;  3DEP A;  1E0B A;  1S4Z A;  5E4W C;  2VXW A;  5CBE E;  2B2V C;  3QO2 A;  1ILP A;  4IUP A;  1HFN A;  2X6G A;  2MGS A;  2RVL A;  1QNK A;  1JE4 A;  2KED A;  4HED A;  4NW2 A;  3LWE A;  1CM9 A;  2SDF A;  3UI2 A;  1MSG A;  1EL0 A;  5D65 A;  2K01 A;  4U68 A;  1SDF A;  2XIW A;  4ZLT F;  1IKL A; 
#chains in the Genus database with same CATH topology
 4A3M G;  1BCP D;  1B3A A;  2VY3 A;  2F0N A;  4RWS C;  1O78 A;  3HKZ E;  3AEV A;  4A3L G;  2SOB A;  3KLS X;  4DUY Q;  1L0Y B;  2IWH A;  4LF5 Q;  3NUC A;  1HZB A;  5DM6 3;  3G4S A;  4LFC Q;  5JEA G;  4A3C H;  1LUZ A;  2HD3 A;  3EA6 A;  2I5L X;  4F8M A;  1U9R A;  3I8Z A;  3MFY A;  1B50 A;  1TXY A;  2K33 A;  4LF8 Q;  2R3Z A;  4B3S L;  2JA5 B;  1HZA A;  2IJ0 A;  1FJG Q;  1VS0 A;  3EJI A;  2K5D A;  4JG2 A;  4C56 C;  3M85 A;  4CJ2 C;  2BDO A;  1A3V A;  3BZC A;  3W2D A;  5C4X B;  1VQ7 A;  2B2U A;  3NBH B;  5KND A;  2NN6 H;  2N8N A;  5E1F A;  3TSS A;  5GAD C;  1UEB A;  2NVQ B;  1OXT A;  4NXM L;  2Z6K A;  3S2D B;  4MTK A;  4IFD I;  3PV0 A;  4YCW A;  5FK9 C;  1F9S A;  3U9O A;  2Q2I A;  1H9S B;  2AQ3 B;  4LUV A;  2C35 B;  1XNQ Q;  3MXN B;  4A3J B;  1B2T A;  1HQR D;  3E0E A;  3HS0 C;  2R93 G;  2KHS A;  3L9A X;  4X65 Q;  1SNQ A;  1H9R A;  2MUY A;  3HOW B;  1XXG A;  3I4O A;  3TN2 A;  3MEF A;  3NEL A;  1Q82 C;  1EOT A;  5JJZ A;  5G3L F;  3CP0 A;  2OEO A;  1R4Q B;  2X69 A;  4CBV A;  3GTQ H;  3BG3 A;  3NQT A;  4P73 A;  1UEA B;  2SNS A;  5IP7 H;  1EQV A;  2JJQ A;  2K03 A;  1I50 B;  5C44 H;  1LT5 D;  4C3H H;  1O7Z A;  3I4L A;  2JA8 G;  2BOS A;  4R8N A;  1OXS C;  1SNC A;  4CDE C;  2UXB L;  5K5P A;  2B2V C;  2ZXO A;  4GKK L;  5I2X A;  4P72 A;  2KBN A;  4IUP A;  4HCE A;  4UHV A;  3T13 A;  2KED A;  3J81 i;  3MAQ A;  4JI4 L;  4BBS H;  1WCM B;  2K01 A;  3GTP B;  5CYU A;  3AYH B;  4IQZ A;  1GUN A;  2L11 A;  4QIW B;  3K5L A;  1KDA A;  4DU9 A;  3NPP A;  5ELC A;  2DNC A;  2X6L A;  4PNY A;  3SK4 A;  2ZM6 Q;  2DJF C;  4JI4 Q;  4GLX A;  1FGB D;  2EY2 A;  1PVO A;  3K8A A;  1LT3 D;  1DD2 A;  4IPG A;  2N88 A;  4FF3 A;  3D8G A;  4GNX C;  1QCB D;  4BY1 H;  4IJL A;  4A3E G;  1TQO A;  5AJ3 Q;  1X55 A;  2HDL A;  3S1Q H;  2RBM A;  4DV2 L;  5A35 A;  4X3T A;  4ULL A;  4JI6 Q;  2H5X A;  2GA4 B;  1KLG D;  1LYL A;  2LFN A;  3ND9 A;  1PZK D;  4FP5 D;  5C5L A;  3SE0 A;  1EY6 A;  1N34 Q;  2VB2 X;  1CHQ D;  1SSO A;  3LNN A;  2KQ3 A;  1UNS A;  2OCE A;  4LJZ C;  2K1B A;  1KQS A;  5J22 A;  4N9P A;  2VQE L;  4XYQ A;  4BXX H;  5CV7 A;  1S72 A;  4LF4 L;  4C1N I;  1WFQ A;  2WII B;  3J80 i;  4DV5 Q;  3R2I A;  1VMP A;  2N3S A;  1JE5 A;  4ID6 A;  3GTO B;  3DWP A;  3IL8 A;  1AFP A;  2L12 A;  3CCM A;  1VCI A;  2VQE Q;  4B3R Q;  1M8A A;  1EIH A;  5M5X B;  3GV3 A;  3CCQ A;  1X65 A;  3HOU G;  4LMQ D;  1QJO A;  1PYW D;  5G3L D;  3GTL B;  1Y1W H;  1B53 A;  3H6M A;  1KIX A;  1SRU A;  2WFW A;  2FFK B;  1E1T A;  4XYO A;  2PI2 A;  1E0B A;  2A74 C;  4DPG A;  4EQO A;  4JYA L;  1B1Z A;  4R1J A;  2X6G A;  4FF4 A;  1SE8 A;  1A3T A;  4DAP A;  1X6O A;  5C44 B;  2N49 A;  1TWF H;  2EYL A;  4L6T B;  2EPB A;  3K0X A;  2Q2T A;  4Y7N H;  4FDB A;  3F2B A;  5JVH 3;  1WOC A;  4OGQ C;  1BF4 A;  1GVP A;  5LHY 1;  3LWU A;  1GUW A;  1B44 D;  2RQX A;  4Q0F A;  2PMZ E;  1O7Y A;  3NTI A;  4JYA Q;  4UDU C;  4FXK C;  4HMJ A;  5C4X G;  1EWH A;  5FJ8 H;  1JJG A;  3I55 A;  1SFO B;  4CJ1 B;  2F0V A;  1F2L A;  1IBK L;  1Z7T A;  1ENC A;  1RTO A;  3BDO A;  1TII D;  2DY8 A;  3J7Z C;  1PV4 A;  1AZP A;  1C8C A;  2VUM H;  2Q2U A;  2BE5 C;  4IUV A;  1LTG D;  3T16 A;  4B3T Q;  5EKL A;  2BA0 A;  2J7Z A;  5D3I B;  1H95 A;  4A3J G;  2Z4I A;  2A69 C;  3T51 B;  2EJM A;  4DV4 L;  5C3W A;  3P75 A;  5C6A A;  1MSH A;  1IBK Q;  2N55 A;  2Q2H A;  3HOW G;  1K8O A;  1A8V A;  1Q3L A;  4JI5 L;  1QUQ B;  1N32 Q;  3TZU A;  1A2U A;  2ES2 A;  4DR4 L;  2Z8L A;  1TWG H;  3OMC A;  3AFQ A;  3VR5 A;  3P7J A;  1OXV A;  2HDM A;  1A15 A;  5D3D A;  4KV6 A;  3CKI B;  3S1R B;  2BH2 A;  3K0Y A;  4BY7 B;  4DV4 Q;  1BVS A;  2LKV A;  2ID0 A;  1X9N A;  1QVC A;  1SE4 A;  2EYF A;  3NTH A;  4APV A;  2NVX B;  4MNO A;  1WTR A;  3PCO B;  2A8V A;  4JI5 Q;  2EZV A;  3PGZ A;  1X3F A;  5GQO A;  1E3P A;  1Y1V H;  3H09 A;  1EYA A;  4IAL A;  1Y8P B;  1MBY A;  1TWA H;  3JC6 6;  4IFD H;  2WAC A;  2VS1 A;  1PFS A;  5BR8 L;  4JVZ A;  4J15 A;  2UUA L;  1NTG A;  5COR A;  2IHF A;  4RGM A;  1EY7 A;  2EY6 A;  2E2I H;  4PQX A;  4OX9 L;  1WCM G;  4EQN A;  3S24 A;  1PA6 A;  4UP9 A;  1EY0 A;  1S4Z A;  1QVF A;  5FO8 B;  2DNE A;  5C0X I;  1EZ6 A;  1QZG A;  4HID A;  5BR8 Q;  1BXT A;  1CM9 A;  1K3B C;  1WTH A;  1L0W A;  4YWK A;  1I6V C;  4U68 A;  4POG A;  4LW1 A;  2EYH A;  4DAM A;  4P2C B;  4BBR H;  4JI2 L;  2CW0 C;  4OX9 Q;  4EGV A;  1CZW A;  4JBW A;  1SAP A;  2HT1 A;  3I3C A;  1SND A;  1CTM A;  1VQJ A;  3T1Y Q;  1XYI A;  2NVT H;  1NY4 A;  5EQ0 A;  1MKH A;  4N9T A;  5T1G A;  4A3I H;  3N52 A;  2D9U A;  5IOC A;  1HR0 L;  3NTK A;  1K8G A;  1A2T A;  1R4P B;  1PTO B;  4O1N A;  4LAA A;  1XJV A;  2QEX A;  1EQR A;  4ZKC B;  3PMF A;  3GTM H;  2KCT A;  4Y7N B;  4JI2 Q;  3J7Y W;  4DN4 M;  2L5T A;  1QE6 A;  4IPC A;  1I4Q A;  1IYJ B;  4R4Q A;  1KDB A;  1YBY A;  4KLK A;  3I73 A;  1JIC A;  1STH A;  2G9H D;  2HQL A;  1AE3 A;  3KBX A;  1HXY D;  1EEF D;  2FMC A;  2NN6 I;  2EE1 A;  2A5H A;  3TP7 A;  2MO1 A;  2NUC A;  2J4X A;  4OL7 A;  2XVS A;  2CH4 A;  4POF A;  5CBA E;  2EXZ A;  3OIQ A;  2BE5 D;  2PPB C;  2R7Z B;  1B70 B;  1YNX A;  1VQ5 A;  1NR2 A;  1FNW A;  5IGC A;  3GTG B;  2B2W A;  4YHH Q;  4DUZ Q;  1ZYR C;  2A69 D;  5I6Y A;  1DGS A;  3KUP A;  4OEM B;  1SJE D;  4JI8 L;  2JA6 H;  3FKI H;  1PTO F;  3ULL A;  3GTJ B;  1M90 C;  5IGG A;  3Q23 A;  3K80 C;  1W6J A;  1DXM A;  4HMI A;  1YI2 A;  4CHT B;  3TBI B;  1ASY A;  1PYS B;  3S17 H;  4DR3 L;  1KRT A;  4J1M A;  1XMO Q;  3CQZ H;  4RKB A;  1HTL D;  5IYD G;  1L2F A;  2RF4 A;  3K59 A;  2KCM A;  3D6C A;  4B9W A;  5IIF A;  3V96 A;  1L1O B;  4LUZ A;  1EEI D;  2ASB A;  3D4W A;  3FHW A;  2CHB D;  4QIW E;  3D0F A;  3STB C;  1UUP A;  1J9O A;  3NHH A;  5FO7 B;  4QUF A;  1E7Z A;  5C44 G;  1XPR A;  1C48 A;  2XSC A;  1KAB A;  1KNA A;  1XX8 A;  3KF8 A;  3RLO A;  5BN5 A;  2YTY A;  3B6Y A;  3DEP A;  5CBE E;  3ITP A;  1D5X C;  3S2H H;  4GN3 B;  1JE4 A;  4GOP A;  4G7O C;  4Z9C B;  3TRE A;  2UXC L;  1GUO A;  3SK5 A;  1IBL L;  5EKI A;  1NR4 A;  3OTO L;  3M4Y A;  2R92 B;  3RUZ A;  2B63 B;  1V1P B;  3KK7 A;  5I9O A;  3AQQ A;  2EVB A;  2V1C C;  5GAH C;  4ALP A;  1SMX A;  1G6Z A;  4PV1 C;  2OTJ A;  2I0Q A;  1L1O C;  1A62 A;  2CW0 D;  2CWA A;  2PZT A;  3ERS X;  1IL2 A;  1CQF A;  3GP7 A;  3VA7 A;  5JJK A;  3PSI A;  2E2J H;  4R4I A;  2XTI A;  1I4H A;  3X3N A;  1HTP A;  2FIN B;  5E3F A;  5KEE A;  2F0K A;  4A3I B;  1LAB A;  2ICI A;  3HOV B;  1NMF A;  5IGD A;  4A3G H;  3GV6 A;  1HPC A;  4K5X A;  4PZ8 A;  4XQN A;  2F0O A;  3A56 A;  5CV5 A;  4C3I H;  2B2T C;  2I5M X;  3CPF A;  5IT9 L;  4BY7 G;  4GKJ L;  1ZEQ X;  1NUC A;  1LLR D;  4K5W A;  4TKO B;  3TRZ A;  3HKS A;  4JOI C;  5NUC A;  2CH4 W;  3A0J A;  3GTK H;  3J7A F;  4DR6 Q;  4HR7 B;  2WKC A;  1HQM C;  1VQP A;  2F52 A;  1BNZ A;  4RCO A;  3OW2 A;  2UXD Q;  3H91 A;  3J7A V;  1WJJ A;  4CDF C;  1DON A;  3Q6S A;  2MPM A;  4GKJ Q;  3I4M B;  5M9O A;  4A3E B;  1PTO D;  3VYU A;  2PMZ B;  1EIF A;  2JE6 I;  1CSP A;  2KA7 A;  1N9W A;  1PH8 A;  1NE3 A;  1NNX A;  5C0X J;  4KHP L;  2MO0 A;  1CA5 A;  2YYZ A;  3BJU A;  5KIX A;  4ZRZ A;  3HOY B;  3WDN A;  3MZ5 A;  1I4P A;  5FLX L;  1YIT A;  4JBM A;  2N78 A;  2A1A A;  5E4W C;  3CPW A;  2HIV A;  1OTC A;  3QO2 A;  3STB D;  4YIJ A;  4OON A;  2B3G A;  1K73 C;  4KHP Q;  3F8T A;  2E74 C;  4ZLT F;  1VQL A;  4QUC A;  1MIU A;  2PQA B;  3H3V I;  2IPK D;  3CCV A;  4DR1 Q;  3DEO A;  1ILQ A;  5IYC H;  4DV6 Q;  2VNU D;  4RKL A;  2EYO A;  4LFB Q;  4NXN L;  1K9M C;  2I5H A;  3A55 A;  4MZ9 A;  3E5S A;  4F88 A;  4K0K Q;  3TS0 A;  1DJR D;  2UUC L;  2QF7 A;  1WYD A;  3BZK A;  2AMC B;  2F0U A;  3SR1 A;  5FJ8 G;  5JOB A;  1E2W A;  1O80 A;  4KKS A;  2E2H H;  1NJI C;  4X3K A;  2IT1 A;  4BS9 A;  4FVM A;  1AZQ A;  2CQO A;  3ULJ A;  4KJN A;  4UP8 A;  2R7Z G;  3U4V A;  5CV8 A;  4A3K H;  4YWM A;  4Y52 H;  1B8A A;  4OO1 I;  3ZYY X;  4DNI A;  4MTN A;  3RZO B;  2VL6 A;  1IHZ A;  1N36 L;  5JPM C;  2IY5 B;  4FO2 A;  3NSW A;  1K28 A;  1PH7 A;  3A8J E;  3M4Q A;  4DR7 L;  5IGF A;  1G2S A;  1EZ8 A;  2B2Y A;  1PZJ D;  2F0M A;  3WOF A;  5IT9 E;  2IL8 A;  2L55 A;  1JOQ A;  3K57 A;  4ZQ3 A;  1W3S A;  3HOZ H;  3NQI A;  1N36 Q;  4A75 A;  1V1Q A;  3CC7 A;  4GLV B;  4JK1 C;  5JJL A;  1LTT D;  3VYR A;  3SGI A;  4B3S Q;  1KTK A;  1LT4 D;  2MQH A;  3AFP A;  4RAU C;  1PH6 A;  1Y1V G;  5DLQ E;  4AYB B;  4HIK A;  4HIO A;  4ZUI A;  4X64 L;  3QWN A;  1QNU A;  1GHK A;  3RMH A;  1NMG A;  1DZ1 A;  4NKL A;  1XMQ L;  1W6K A;  5ELN A;  1SYC A;  1ML0 D;  2UUB L;  2R92 G;  3A8K E;  5IP9 G;  2B63 G;  1SYE A;  1D8L A;  4NXM Q;  2RHQ B;  4JBJ A;  2K5N A;  1ILP A;  5I6W A;  3UI2 A;  4CDC C;  3E0J A;  4H7B A;  4M8A A;  5FLX E;  1UE1 A;  3PO2 B;  3PO3 H;  4A93 H;  2K28 A;  2K05 A;  2Z4H A;  3H0G H;  3ND8 A;  3ER0 A;  4IJH A;  4BBR G;  5E4X A;  3P20 A;  4X66 L;  2K7V A;  3QIA A;  2UUB Q;  2PYK A;  4B9X A;  2MNA A;  1PH5 A;  2H1E A;  1QIL A;  4GNX B;  3RZD B;  5EPJ A;  4YY3 L;  2RA4 A;  1TWC B;  5KRU A;  2K04 A;  4A3I G;  1CFM A;  1D5Z C;  5ELF A;  4EQP A;  3C1F A;  3HOV G;  5K36 H;  2A19 A;  4C3J H;  1HFG A;  2RCF A;  2A6H C;  3ERQ A;  2YTV A;  3HOX H;  3S1N H;  4DGZ A;  5M3F B;  2JN4 A;  3IFD A;  4ZCK A;  2R61 A;  1R9T B;  1K83 H;  1M1K C;  4KMU C;  3CRK C;  1FNV A;  1BBX C;  4X66 Q;  1HNZ L;  1K8A C;  2JA7 H;  1TS2 A;  3S16 H;  1PFN A;  1KLU D;  1LTS D;  2QCP X;  4WJ3 M;  1VQD A;  4R4C A;  2UXB Q;  3A74 A;  2Z0S A;  1PH4 A;  1GJX A;  4GKK Q;  1JB7 A;  3IAY A;  4KI0 A;  3A7L A;  2OT2 A;  3OMG A;  3H94 A;  2SNM A;  2LXK A;  3S15 H;  2WB1 B;  2EYJ A;  1JWM D;  2F4V L;  5FLM H;  4ME3 A;  1F9Q A;  1DOM A;  2L15 A;  1I4G A;  3I4N H;  3I4M G;  1HUM A;  2VB3 X;  3MWY W;  4IUQ A;  3NBH A;  4PMC A;  4IUT A;  1AEX A;  5DNF A;  4K14 A;  3KYH C;  5M3M H;  1SEB D;  3SDZ A;  1BBU A;  3JAM L;  4AH6 A;  2PO4 A;  2NZH A;  1PRT B;  4DAY B;  2KCN A;  3HOY G;  4HCS A;  3L2P A;  4OWT B;  3RNU A;  2B2V A;  4YWL A;  1YZ6 A;  3O13 A;  1TWH H;  1H9S A;  2ENB A;  3DUZ A;  2M00 A;  3MXN A;  1WTW A;  3PIP A;  1YJN A;  4KTA A;  5KNB A;  3DXJ C;  2I46 A;  2WP8 J;  3KLW A;  3UDF A;  3W5O A;  5ELO A;  4TSS A;  4DV2 Q;  1VQ6 A;  5T1I A;  2MHV A;  3NBI A;  4U67 3;  4KK7 A;  3Q22 A;  3BVG A;  3U50 C;  4YCV A;  2A6E C;  5IWA L;  2CWP A;  3OIP A;  3TS2 A;  1JQY D;  4KKT A;  1P16 A;  3L7Z C;  2MGS A;  1HNX L;  3FPP A;  3D3R A;  2WV6 D;  1EL0 A;  1AE2 A;  2F0I A;  1YHQ A;  4AQY L;  1JB3 A;  1E2Z A;  4X62 L;  4GNX A;  2D0P A;  4DXG A;  1PRT F;  1X56 A;  1PRT C;  1FVI A;  3SK8 A;  1XTD A;  4LF4 Q;  3FP9 A;  5IWA Q;  1JWS D;  2ZT9 C;  3S1M H;  1RTN A;  3GTQ B;  1HNX Q;  1MI2 A;  2ZJQ A;  2KEC A;  4A3D H;  4IPH A;  4AQY Q;  3I2Z A;  4JI0 L;  3PUZ A;  4C3H B;  1VQA A;  4XIG S;  1KC8 C;  5C3X A;  1D7Q A;  3H3V H;  1WTX A;  2A6H D;  4DK0 A;  2KJX A;  2GN5 A;  2QIL A;  1PYB A;  1Q7Y C;  2O5I C;  3MC0 B;  1A3U A;  2NB0 A;  1RL2 A;  1ZKO A;  4BBS B;  4JI0 Q;  5M5W H;  1MJE A;  4A3F H;  1STY A;  3QB3 A;  1ENF A;  1PDQ A;  1TY0 A;  5DEH A;  3FDT A;  4WRD A;  2Z6B A;  1F2M A;  3KLS A;  3E6Z X;  3ONA B;  1IBM L;  4JCV E;  4IFD J;  4AYB G;  2FMM A;  2F0H A;  1TS4 A;  1ESR A;  4DK3 C;  3P1H A;  1NSN S;  4HSV A;  2VW9 A;  1JT8 A;  4OO1 H;  4CGY B;  1SNO A;  4H13 C;  1ET6 A;  1U4P A;  1JR0 D;  3A7A B;  4XDX A;  1HZ9 A;  5C4H A;  4ABN A;  1WI5 A;  2AQ1 B;  2XWJ B;  4BY1 B;  2KEE A;  5EPK A;  2EYP A;  3CCE A;  1A0I A;  4A3M H;  1JMC A;  3S1Q B;  3JAM E;  1G2T A;  3N6R A;  4XT1 B;  5A2Q L;  1Y14 B;  3D6W A;  2HUG A;  1WTV A;  2B8G A;  2R6G A;  1CT1 D;  4A3L H;  3AMU A;  4F87 A;  4ZYS A;  3PO2 G;  5IGB A;  4LF9 L;  2E76 C;  1V43 A;  4IZ8 A;  5C5M A;  5JEA H;  3D4R A;  3DLL A;  3M3Y H;  1U5K A;  2VXW A;  3QR8 A;  1XTC D;  3J81 L;  4KY7 A;  1IZ6 A;  1HFN A;  5IYB G;  3VDY A;  3EFX D;  4DR4 Q;  1VF7 A;  4JPB W;  2K5Q A;  1Q1B A;  4LFA L;  2KHI A;  3K7U C;  1IW7 C;  3RLN A;  1G29 1;  2QGQ A;  2LXJ A;  5M3F G;  4ZAI A;  1SYB A;  3SVM A;  3PF5 A;  2OTL A;  3I7F A;  2ATW A;  1E24 A;  1K0S A;  1IXR A;  3BZD B;  3A5U A;  4IUN A;  4NMZ A;  5JPN C;  2QDB A;  3BYT B;  1CKM A;  4LFA Q;  5C0X G;  1PRT D;  1FD7 D;  3CCS A;  2UUA Q;  1Y1W B;  2D0O A;  2R93 H;  1ENA A;  3BDC A;  5D14 A;  2WB1 G;  4JI7 L;  1D2B A;  3G7L A;  4K6D A;  2D2C C;  4HTH A;  3CCR A;  1SNP A;  1EY9 A;  1V1O A;  1KRS A;  3QJY A;  2ZXP A;  4AYB E;  1I3Q H;  5E7N A;  2MJ8 A;  5C4J H;  1QVG A;  4A3C G;  1TWF B;  5KGU A;  3KFU A;  4AIM A;  1HA5 A;  2HIX A;  1LT6 D;  1B9M A;  1D1K A;  1QOH A;  4IUU A;  2P5Z X;  5EBD A;  3C46 A;  2JA9 A;  2Y0S B;  1LTL A;  1K3R A;  1TT2 A;  2JA8 H;  4GS3 A;  3S14 H;  1HR0 Q;  3J80 L;  1YJW A;  2XN9 C;  4A3B H;  1M4V A;  2NN6 G;  2LY7 A;  1QUQ A;  3K5N A;  3L3O C;  4BA2 I;  1C9O A;  3MHB A;  2OF1 A;  4UPA A;  5AFW A;  4IOC A;  1KL9 A;  2MFI A;  2XGT A;  3MXU A;  2VUM B;  1CZG A;  5C3E H;  2HCC A;  1YNJ C;  4EQ5 A;  1V8Q A;  2RHS B;  3C3L A;  4K8I A;  3F2C A;  3PUV A;  4BWG B;  1U4L A;  5IY0 A;  4OXP A;  5LMN L;  1XPO A;  4LUO A;  1RJT A;  4ME5 A;  2EYM A;  3VR4 A;  5CV6 A;  5J1Z A;  3H3V C;  2OQK A;  5HY6 A;  1VQ8 A;  5A2Q E;  1VQO A;  1GM5 A;  1TWG B;  1HR0 W;  3BU2 A;  4FF1 A;  4TQU S;  4GOP C;  3KDF B;  1BKB A;  3R3O A;  4JC0 A;  2E5L L;  2G9D A;  4NW2 A;  5C4Z A;  5D65 A;  3U4Z A;  3EIV A;  4JI8 Q;  1X3G A;  5I4D A;  5LMN Q;  4A76 A;  1HH2 P;  2TSS A;  2NVY H;  1RD9 D;  3H0G G;  5LL6 X;  4G7Z C;  5IP7 G;  3J81 E;  1DCZ A;  2I07 B;  2GVA A;  3I90 A;  2F0F A;  4C3H G;  1EYG A;  3OW7 A;  1Y1V B;  3BVM A;  1YHB A;  4DR3 Q;  3EBE A;  1IW7 D;  2WIN B;  2WB1 E;  3HGB A;  5EAY A;  5CGK A;  4PG3 A;  1TWA B;  1UAP A;  2E5L Q;  2WKD A;  1EU3 A;  4X6A H;  2FHT A;  1OXX K;  1E1O A;  2E2I B;  2PW7 A;  4EX5 A;  4BBS G;  1LTI D;  1XWE A;  2RKS A;  5JVG 3;  1U4M A;  1SJH D;  1I6H H;  2B39 A;  1VQM A;  2YU9 H;  2WAQ B;  1GD7 A;  3W1B A;  2PQE A;  3DHQ A;  3KOJ A;  2KVM A;  4BBR B;  1TY2 A;  2UXC Q;  1B3Q A;  1IBL Q;  1YEZ A;  4C1N K;  2EQS A;  4KD4 A;  4DR2 L;  3OTO Q;  1CKN B;  2OQ0 A;  1BOS A;  1EWI A;  2NVT B;  4CKE A;  3NEM A;  3HOU H;  2R7F A;  3C1E A;  4BY1 G;  5LMU L;  3T1H L;  2CKZ B;  5M3M G;  1HJP A;  1CKO A;  1V9P A;  3OPO A;  2F0Q A;  3GTM B;  4UAI A;  4RFB A;  2JSO A;  3KF6 B;  3MA2 B;  2QDL A;  3CCJ A;  5IT9 c;  2C5C A;  4L5R C;  2NTS A;  4DV1 L;  2AKW B;  5GRO A;  4OWW B;  4L5Q A;  1WTO A;  4NDX A;  3VR3 A;  2L1B A;  4WJW A;  1X54 A;  2DY7 A;  3J80 E;  4HJA A;  1YHA A;  1PH2 A;  2PZW A;  2KCC A;  2JA5 H;  1DM0 B;  1CK1 A;  3PQI A;  2PNH A;  4OIK A;  1WTQ A;  4JV5 L;  4HJ8 A;  5ELB A;  3OWF A;  1X3E A;  4BXX G;  4G4K A;  2M9V A;  3NXW A;  3ZJY C;  1L1O A;  5C4X H;  5C3E B;  1TS3 A;  4DXF A;  1ZYR D;  2ICE C;  4DV1 Q;  3V2T A;  3J7A 5;  1GXD C;  1QNK A;  1DYQ A;  3LWE A;  1PXU A;  2NVQ H;  4MIU A;  1MSG A;  2JA6 B;  3FKI B;  3OWE B;  1STA A;  1SDF A;  3S2D H;  3VYT A;  1HZC A;  3CAM A;  1OXU A;  4JV5 Q;  4QCL A;  5JJI A;  2HHH L;  4N8F A;  3S17 B;  2JK8 A;  3CQZ B;  4A3J H;  1Y1W G;  1I4R A;  1LTR D;  4LNQ A;  1Z9F A;  1S5C D;  2XWB B;  5HGT A;  2B2T A;  1N8R C;  3HOW H;  4QL5 A;  2DGY A;  3WOE A;  2EXD A;  3FVQ A;  5HUR A;  3R2T A;  1Q86 C;  1EFW A;  1SMY C;  1C7Y A;  1EYD A;  1STN A;  1V1P A;  3TEH B;  3VYS A;  1HUN A;  4JOI A;  5EJW A;  2HHH Q;  3A8I E;  5LL6 S;  4DKA C;  2HQE A;  4HJ9 A;  4DV3 L;  2AHO B;  1GHJ A;  3MFG A;  3SHL A;  2L4N A;  3S2H B;  1XNR L;  4MN3 A;  1I50 H;  3F2D A;  4P71 A;  3D31 A;  3W1G A;  1B7Y B;  2K50 A;  1X3Q A;  2Y0S G;  1FYC A;  3X3M A;  3SEB A;  3KJO A;  2FJ2 A;  1SRO A;  4DR5 L;  4A3F G;  1ET9 A;  4RHR A;  4ZKB B;  1HCZ A;  3R8B A;  4L8J A;  1LTA D;  1Z47 A;  1RDP D;  4GZY C;  2JEB I;  1AW7 A;  2QEJ C;  3FEW X;  5CR3 A;  2M2L A;  1Q12 A;  3LX0 A;  4NXN Q;  1WCM H;  2NZ1 D;  3GDE A;  2VUM G;  2F0W A;  1KAW A;  3GTP H;  4GLA C;  2F03 A;  2F0P A;  1D6E C;  5HGQ A;  2B2U C;  1EU4 A;  3FMC A;  4DUY L;  4LF5 L;  2UUC Q;  3PUW A;  2E2J B;  4OO1 G;  4ILW A;  1X32 A;  1Y69 U;  1WD1 A;  1ROD A;  4LFC L;  1H9K A;  2Z6K C;  2CCZ A;  1SR3 A;  4X3S A;  1J5E L;  1U4R A;  2JYO A;  2TMP A;  4IPD A;  4Q5V A;  1EY5 A;  5ISR A;  3G6E A;  3HFZ B;  4LF8 L;  4HSP A;  2ZXR A;  5FKA C;  4WJ4 A;  1HHV A;  4A3G B;  4KHV A;  1FJG L;  3U9S A;  1W2B A;  1ESF A;  5IE8 A;  4H44 C;  4C3I B;  2AWN A;  5KNC A;  2A73 B;  4OWX B;  1ASZ A;  1WD0 A;  1O7I A;  2RDF A;  2AUJ D;  2EIF A;  4DK1 A;  4V19 0;  3K58 A;  1CHP D;  1J5E Q;  4G7H C;  1S5E D;  3VR2 A;  3DMU A;  3TDQ A;  1SXT A;  1Z6H A;  2J0T D;  1K0R A;  2SDF A;  3GTK B;  1S5D D;  2BA1 A;  4DR7 Q;  2F0E A;  1IKL A;  1LTB D;  4IFD G;  3RN2 A;  3PF4 A;  1XNQ L;  2ALY B;  1AH9 A;  1YNN C;  2K5H A;  3OOC A;  3ICE A;  1JOK A;  5IGE A;  2Q8R E;  4H0L C;  1I4X A;  3GQB A;  4X65 L;  3PIO A;  2DUD A;  3LGJ A;  1VQG A;  1STE A;  1TVX A;  2WAQ G;  2K14 A;  4FYD A;  2PQA A;  2ZTD A;  4X64 Q;  2Y0S E;  3HZX A;  1MJC A;  3NWS A;  3PIP 3;  2EJG C;  2KOL A;  5JAV A;  4O0A A;  3GTO H;  1GOZ A;  4R4T A;  4HN7 A;  1XMQ Q;  1SMY D;  1UE6 A;  4CKB A;  5M5X H;  4K5V A;  3A54 A;  2XRQ D;  3KJP A;  3Q24 A;  3GTL H;  2BDN A;  5IYD H;  1KDC A;  3I91 A;  3F1Z A;  2K6A A;  1AP0 A;  1Q90 A;  4HJ7 A;  1JC7 A;  4KD3 A;  4NP5 A;  3H15 A;  3GD7 A;  3MTS A;  4R8I A;  4DV0 L;  3L0O A;  2C9O A;  4YY3 Q;  1PHJ A;  3CME A;  2EDG A;  5KYL A;  1C0A A;  2EOT A;  4A3B G;  2E2H B;  3T4A C;  1B9N A;  1BUV T;  3CU7 A;  1H9M A;  3QG1 A;  4LF6 L;  5GAE C;  1SNM A;  4KN7 C;  4QB4 A;  2O2L D;  5L37 A;  2ZM6 L;  5DAU A;  4QF4 A;  3Q0A A;  5GAG C;  1L0X B;  1NCV A;  5FO9 B;  1HNZ Q;  1CI3 M;  5C3E G;  4A3K B;  3OYY A;  3I56 A;  4QQB X;  4XT3 B;  1SFO H;  4DV0 Q;  1WTP A;  3M4O H;  1GUG A;  4A4I A;  2Z9H A;  1YJ9 A;  3JAM c;  5AJ3 L;  4OIJ A;  4XQJ A;  2JA6 G;  1QWY A;  3FKI G;  4TVA B;  1BBW A;  3CCU A;  4LF6 Q;  3BVZ A;  4JI6 L;  4JI3 L;  2F3I A;  4IN3 A;  2IX1 A;  2F4V Q;  1N34 L;  3KBG A;  3VR6 A;  1Y8N B;  1LM0 A;  3CD6 A;  1GKH A;  2WAQ E;  1VQB A;  3D4D A;  1Q1E A;  4FNF A;  3AB9 A;  4K8J A;  3CCL A;  3HOZ B;  1G6P A;  2RSO A;  3HEJ A;  2ZTC A;  2EY5 A;  4JI3 Q;  4LWC A;  4RH6 A;  1JOO A;  4RMF A;  2HCI A;  3DM3 A;  2XNA C;  4DNT B;  3S1R H;  1Q46 A;  4BY7 H;  2L9H A;  2PNR C;  1YNN D;  1FR3 A;  2CVR A;  4FF2 A;  4DV5 L;  2AUK A;  2KUM A;  2NVX H;  2F0S A;  3C2P A;  1Y8O B;  1VF5 C;  1G8Z D;  4GN5 A;  3TQY A;  3MXP A;  4B3R L;  2K5V A;  2RCN A;  1DOL A;  1KHI A;  1F9R A;  5EGT A;  4KN4 C;  1TS5 A;  1PZI D;  4CJ0 B;  2QKI C;  3MEH A;  1HRJ A;  1LAC A;  1VQH A;  3G6J B;  1MGS A;  3PO3 B;  4A93 B;  3EVQ A;  2A68 C;  1HA6 A;  3H0G B;  1NAP A;  3CW2 C;  1NBW A;  1T9H A;  4DNR B;  1VMC A;  4X62 Q;  3M7N A;  3TZD A;  1IYV A;  1QZH A;  3I72 A;  4CKC A;  4RGO S;  2LSS A;  1KAA A;  4P74 A;  5I2Y A;  4R9W A;  1MD2 D;  3VA5 A;  4C3J B;  4A3G G;  3EN2 A;  3S1N B;  3HOX B;  4G57 A;  1VQ9 A;  3E9H A;  4C3I G;  1K83 B;  1OO9 B;  4KJO A;  5JEA J;  1CA6 A;  1BDO A;  3MVV A;  4M1U B;  1VQN A;  2JA7 B;  3K7A H;  1PTO H;  4DFA A;  4L5S A;  3S16 B;  1EY8 A;  1TU2 B;  1JJC B;  3GO5 A;  3RD4 A;  1VQC A;  4FXD A;  2JA5 G;  2MP1 A;  1JCK B;  1EQT A;  4XXE A;  1PLF A;  4DAY A;  4B3M L;  4B3T L;  4J8Q A;  3RR5 A;  3T53 B;  3R93 A;  2IX0 A;  1G91 A;  1YVC A;  2BH8 A;  2E8G A;  2GVB A;  1PH1 A;  3PUY A;  3S15 B;  5CC4 A;  3QOL A;  4DAV A;  1JOR A;  4I7A A;  2RVL A;  3I4N B;  3M4O B;  5H1S E;  1SN8 A;  5I9P A;  1N32 L;  2Z1C A;  3CXC A;  2JP1 A;  5M3M B;  3G48 A;  3UE0 A;  1IBM Q;  2R7Z H;  1TR5 A;  4B3M Q;  4X3U A;  3GTG H;  3A5Z B;  5KYI A;  1FNU A;  1SYD A;  3I70 A;  2D5D A;  3CRL C;  3J81 c;  1TWH B;  3GTJ H;  5TSS A;  4L63 B;  3UDG A;  2E2D C;  3E9I A;  1Q81 C;  3V05 A;  4K2L A;  2KHJ A;  1PFB A;  1MHW C;  3E3X A;  2V4D A;  1ZXT A;  1Q8K A;  3TP6 A;  1X3P A;  2F3W A;  2A6E D;  5ELD A;  1VQ4 A;  3PUX A;  4LF9 Q;  1RKN A;  5IYC G;  4WFN 3;  4JI1 L;  4LK1 C;  4PZ7 A;  3HKZ B;  2RDG A;  1VDZ A;  5EKK A;  4WOR A;  3J81 j;  3K5M A;  2K32 A;  1GUS A;  2B8F A;  2O5J C;  2O4X A;  4NB3 A;  2D62 A;  4DK6 C;  3NE5 B;  4QJF A;  3RLF A;  4RGT A;  3OSO A;  4QGU A;  1C4Q A;  4JI1 Q;  5EBC A;  3S1M B;  4HAE A;  2A68 D;  1RCV D;  2R92 H;  3NP8 A;  4A3K G;  5IP9 H;  2B63 H;  4A3D B;  3T1Y L;  1BO0 A;  3UDX A;  1GUT A;  1GO3 E;  2F0D A;  3KF8 B;  2FXQ A;  3FPU B;  4BA1 I;  1VQK A;  1G51 A;  1F2Y A;  3CHB D;  2ZJP A;  1U0L A;  3M4P A;  2L0C A;  4RCN A;  4IO9 A;  1S40 A;  4JBK A;  3IRB A;  1D5M C;  1P8L A;  3DWA A;  2B2W C;  3EQL C;  4GOP B;  3U58 A;  4JI7 Q;  4DA2 A;  4TRD A;  1SYF A;  1E2V A;  3CF5 A;  1SE3 A;  1EQQ A;  3TP8 A;  3J80 c;  3DWQ A;  1EUJ A;  5M5W B;  1D1I A;  4A3F B;  3K7A B;  3ULP A;  3HOV H;  5BN4 A;  1LO5 D;  3HOZ G;  1S3O A;  1VQE A;  1XPU A;  1ICF B;  1Q8I A;  3ERO A;  2DN8 A;  4K2K A;  4YHH L;  3S9W A;  4DUZ L;  3KLR A;  3K5O A;  2F3V A;  2YTX A;  1II3 A;  3DM1 A;  2JQO A;  4NPS A;  1KD1 C;  4E6I A;  2H4O A;  1KNE A;  2RDH A;  3K6O A;  1A6X A;  3NWT A;  1EIG A;  1CQV A;  2EY1 A;  3TP5 A;  2OWO A;  1F77 A;  4J6H A;  4A3M B;  2G5D A;  2QW7 A;  1XMO L;  4N8X 1;  5EPL A;  4K6L A;  4JW0 A;  4FXG C;  2NTT A;  5CV9 A;  4F7X A;  2QA4 A;  2YV5 A;  2F0T A;  3I4M H;  2AQ2 B;  3RN5 A;  1A63 A;  1WVL A;  4A3E H;  3PO3 G;  4A93 G;  1ICW A;  2AWO A;  2OXP A;  3M3Y B;  1PTO C;  1I5F A;  1RIP A;  2PI2 E;  1SYG A;  1JWU D;  2CFM A;  4DV7 L;  3HOY H;  1QB5 D;  2CQA A;  3IKJ A;  1RF2 D;  3Q8D A;  4O42 A;  1STG A;  5K36 G;  4C3J G;  5DM7 3;  2VZA A;  4O2D A;  5F2D A;  3HOX G;  1BCP B;  4QY7 A;  2VQF L;  2R7D A;  1FGU A;  1PMR A;  2JA7 G;  2F0G A;  4C2M H;  3NEN A;  1J8I A;  4KY6 A;  4DV7 Q;  4RGN A;  5M5Y H;  5LMN W;  1EYC A;  1UWV A;  1F2Z A;  2NYZ D;  4I65 A;  1F9P A;  3HRZ C;  2JEA I;  3W3A A;  3T56 B;  2F0L A;  3CC2 A;  1SBB B;  1CUK A;  3FRP B;  1HNW L;  2VQF Q;  2R93 B;  3NK9 A;  3F2U A;  1FL0 A;  5COY A;  5FLM G;  1IKM A;  4KKU A;  2PW5 A;  4S3S A;  2F4I A;  2NWG A;  3M7G A;  3CC4 A;  3I4N G;  1I3Q B;  1EWC A;  5C4J B;  2PZU A;  1QG7 A;  1BCP F;  2PCF B;  1BCP C;  4KY5 A;  4UY8 C;  1HNW Q;  4PMB A;  3RZO H;  4DR2 Q;  4H02 A;  4HED A;  3HG9 A;  2JA8 B;  1SLJ A;  2NBF A;  2IHE A;  4RG1 A;  3S14 B;  4LF7 L;  5LMU Q;  3T1H Q;  4ODG A;  2E75 C;  1TKW B;  4A3B B;  1T5X D;  2LMC B;  4ZK9 B;  4L5T A;  3TME A;  4OEL B;  1JJ2 A;  4XTC S;  4DR6 L;  1YIJ A;  4YCU A;  3CMA A;  4XQQ A;  3KDF A;  3UDI A;  1BR9 A;  2UU9 L;  1YNJ D;  2UXD L;  4HIM A;  1IYU A;  1H9J A;  4RHS A;  4B08 A;  2JXM B;  3QOJ A;  3HKZ G;  1AN8 A;  4LF7 Q;  1PFM A;  4HJ5 A;  3SXH A;  1B4O A;  4EVO A;  2F1M A;  1DOK A;  3OHX C;  5IOD A;  3BYY B;  3IFT A;  2DJG C;  4I7Z C;  4IUR A;  5FLX c;  1J6Q A;  2UU9 Q;  2K4K A;  4MHE A;  1BQQ T;  1IL8 A;  3AU7 A;  3HP3 A;  4CDD C;  2IW3 A;  4QMG A;  2K5W A;  1CSQ A;  4A3D G;  1STB A;  2NVY B;  4DF7 A;  1PH3 A;  1S5F D;  2Q8I B;  1KXL A;  2ZTE A;  5J3B A;  4IOA A;  4ZUJ A;  2Q8T A;  1I94 L;  3BDL A;  1VQF A;  4PZ6 A;  1EIY B;  3URY A;  1EOV A;  3K81 C;  4DR1 L;  3PO2 H;  4DV6 L;  4LFB L;  3MXG A;  2EJF C;  2F0J A;  2K52 A;  2BCO A;  3G71 A;  2SEB D;  1E22 A;  1S5B D;  3PIO 3;  2RSN A;  1SE2 A;  3JAM i;  4K0K L;  1N33 L;  1O7L A;  3RZD H;  5IYB H;  3WWV A;  1CKN A;  1TWC H;  4P75 A;  5BN3 A;  5CMD A;  1PH9 A;  1I94 Q;  3SK6 A;  4C2M B;  1T5E A;  1I6H B;  4RA8 A;  5M5Y B;  2IX3 A;  4OHJ A;  2YU9 B;  2XRS D;  4DV3 Q;  5M3F H;  2K75 A;  4KHZ A;  1R9T H;  2B2Y C;  2NZO A;  3BS1 A;  1UE5 A;  5FOB B;  1XNR Q;  3KF6 A;  4GN4 B;  4UP7 A;  2KEN A;  5J39 A;  1RHP A;  3M9B A;  1LV9 A;  1N33 Q;  1EY4 A;  2LS0 1;  2B29 A;  5CV4 A;  1VQI A;  5C0X H;  4DR5 Q;  4PMW A;  1K8M A;  3UE1 A;  4R4O A;  2ZJR A;  3HOU B;  5ELE A;  1UE7 A;  4V0B A;  1EFI D;  1ONL A;  2XIW A; 
#chains in the Genus database with same CATH homology
 1BCP D;  1B3A A;  2F0N A;  4RWS C;  1O78 A;  2SOB A;  3KLS X;  1L0Y B;  2IWH A;  3NUC A;  5DM6 3;  5JEA G;  3EA6 A;  4F8M A;  1U9R A;  3I8Z A;  3MFY A;  1B50 A;  2K33 A;  2R3Z A;  2JA5 B;  2IJ0 A;  3EJI A;  2K5D A;  4C56 C;  3M85 A;  4CJ2 C;  2BDO A;  1A3V A;  3W2D A;  5C4X B;  2B2U A;  5KND A;  2NN6 H;  5E1F A;  3TSS A;  2NVQ B;  1OXT A;  3S2D B;  4IFD I;  3PV0 A;  5FK9 C;  1F9S A;  3U9O A;  1H9S B;  2AQ3 B;  4A3J B;  1B2T A;  1HQR D;  3HS0 C;  2KHS A;  3L9A X;  1SNQ A;  1H9R A;  2MUY A;  3HOW B;  1XXG A;  3TN2 A;  1EOT A;  5JJZ A;  5G3L F;  2OEO A;  1R4Q B;  2X69 A;  4CBV A;  3BG3 A;  3NQT A;  1UEA B;  2SNS A;  1EQV A;  2K03 A;  1I50 B;  1LT5 D;  1O7Z A;  3I4L A;  2BOS A;  4R8N A;  1OXS C;  1SNC A;  5K5P A;  2B2V C;  2ZXO A;  5I2X A;  4IUP A;  4HCE A;  3T13 A;  2KED A;  3MAQ A;  1WCM B;  2K01 A;  3GTP B;  5CYU A;  4IQZ A;  1GUN A;  2L11 A;  4QIW B;  3K5L A;  1KDA A;  4DU9 A;  3NPP A;  5ELC A;  2DNC A;  2X6L A;  4PNY A;  3SK4 A;  1FGB D;  2EY2 A;  1LT3 D;  1DD2 A;  2N88 A;  4FF3 A;  3D8G A;  1QCB D;  1TQO A;  2HDL A;  2RBM A;  5A35 A;  4X3T A;  4ULL A;  2GA4 B;  1KLG D;  2LFN A;  3ND9 A;  1PZK D;  4FP5 D;  5C5L A;  3SE0 A;  1EY6 A;  2VB2 X;  1CHQ D;  1SSO A;  3LNN A;  2KQ3 A;  1UNS A;  4LJZ C;  2K1B A;  5J22 A;  4N9P A;  4XYQ A;  5CV7 A;  4C1N I;  2WII B;  3R2I A;  1VMP A;  4ID6 A;  3GTO B;  3DWP A;  3IL8 A;  1AFP A;  2L12 A;  1VCI A;  1M8A A;  1EIH A;  5M5X B;  3GV3 A;  4LMQ D;  1QJO A;  1PYW D;  5G3L D;  3GTL B;  1B53 A;  3H6M A;  2FFK B;  4XYO A;  1E0B A;  2A74 C;  4EQO A;  1B1Z A;  2X6G A;  4FF4 A;  1A3T A;  4DAP A;  5C44 B;  2EYL A;  4L6T B;  2EPB A;  5JVH 3;  4OGQ C;  1BF4 A;  5LHY 1;  3LWU A;  1GUW A;  1B44 D;  2RQX A;  4Q0F A;  1O7Y A;  3NTI A;  4UDU C;  4FXK C;  4HMJ A;  1EWH A;  1SFO B;  4CJ1 B;  2F0V A;  1F2L A;  1Z7T A;  1ENC A;  1RTO A;  3BDO A;  1TII D;  2DY8 A;  1AZP A;  1C8C A;  2BE5 C;  4IUV A;  1LTG D;  3T16 A;  5EKL A;  2BA0 A;  2J7Z A;  5D3I B;  2Z4I A;  2A69 C;  3T51 B;  2EJM A;  5C3W A;  3P75 A;  5C6A A;  1MSH A;  2N55 A;  1K8O A;  1Q3L A;  3TZU A;  1A2U A;  2Z8L A;  3OMC A;  3VR5 A;  3P7J A;  1OXV A;  2HDM A;  1A15 A;  5D3D A;  4KV6 A;  3CKI B;  3S1R B;  3K0Y A;  4BY7 B;  2LKV A;  2ID0 A;  1SE4 A;  2EYF A;  3NTH A;  2NVX B;  1WTR A;  2EZV A;  3H09 A;  1EYA A;  4IAL A;  1Y8P B;  1MBY A;  4IFD H;  2WAC A;  5COR A;  4RGM A;  1EY7 A;  2EY6 A;  4PQX A;  4EQN A;  1EY0 A;  1S4Z A;  5FO8 B;  2DNE A;  5C0X I;  1EZ6 A;  1BXT A;  1CM9 A;  1ONL A;  1I6V C;  4U68 A;  2EYH A;  4P2C B;  2CW0 C;  4EGV A;  1CZW A;  4JBW A;  1SAP A;  3I3C A;  1SND A;  1CTM A;  1XYI A;  5EQ0 A;  4N9T A;  5T1G A;  3N52 A;  2D9U A;  5IOC A;  3NTK A;  1A2T A;  1R4P B;  1PTO B;  4O1N A;  4LAA A;  4ZKC B;  3PMF A;  4Y7N B;  3J7Y W;  4DN4 M;  2L5T A;  1QE6 A;  1I4Q A;  1KDB A;  3I73 A;  1JIC A;  1STH A;  2G9H D;  3KBX A;  1HXY D;  1EEF D;  2FMC A;  2NN6 I;  2EE1 A;  2A5H A;  3TP7 A;  2NUC A;  2J4X A;  4OL7 A;  2XVS A;  5CBA E;  2EXZ A;  3OIQ A;  2BE5 D;  2PPB C;  2R7Z B;  1NR2 A;  1FNW A;  5IGC A;  3GTG B;  2B2W A;  1ZYR C;  2A69 D;  5I6Y A;  3KUP A;  1SJE D;  1PTO F;  3GTJ B;  5IGG A;  3Q23 A;  1W6J A;  1DXM A;  4HMI A;  4CHT B;  3TBI B;  4J1M A;  4RKB A;  1HTL D;  3K59 A;  3D6C A;  4B9W A;  5IIF A;  3V96 A;  1EEI D;  3D4W A;  2CHB D;  1UUP A;  1J9O A;  3NHH A;  5FO7 B;  4QUF A;  1C48 A;  2XSC A;  1KAB A;  1KNA A;  1XX8 A;  3KF8 A;  5BN5 A;  3DEP A;  5CBE E;  3ITP A;  1D5X C;  1JE4 A;  4G7O C;  4Z9C B;  1GUO A;  3SK5 A;  5EKI A;  1NR4 A;  3M4Y A;  2R92 B;  3RUZ A;  2B63 B;  1V1P B;  3KK7 A;  5I9O A;  2EVB A;  1G6Z A;  4PV1 C;  2CW0 D;  2PZT A;  1CQF A;  3GP7 A;  3VA7 A;  1I4H A;  3X3N A;  1HTP A;  2FIN B;  5E3F A;  5KEE A;  2F0K A;  4A3I B;  1LAB A;  2ICI A;  3HOV B;  5IGD A;  3GV6 A;  1HPC A;  4K5X A;  4XQN A;  2F0O A;  3A56 A;  5CV5 A;  2B2T C;  5IT9 L;  1ZEQ X;  1NUC A;  1LLR D;  4K5W A;  4TKO B;  5NUC A;  3J7A F;  4HR7 B;  2WKC A;  1HQM C;  1BNZ A;  4RCO A;  3H91 A;  3J7A V;  1DON A;  3Q6S A;  2MPM A;  3I4M B;  5M9O A;  4A3E B;  1PTO D;  3VYU A;  2PMZ B;  2JE6 I;  2KA7 A;  5C0X J;  1CA5 A;  2YYZ A;  5KIX A;  4ZRZ A;  3HOY B;  3WDN A;  3MZ5 A;  1I4P A;  5FLX L;  5E4W C;  3QO2 A;  4YIJ A;  2E74 C;  4QUC A;  2IPK D;  3DEO A;  1ILQ A;  2VNU D;  4RKL A;  2EYO A;  3A55 A;  3E5S A;  4F88 A;  1DJR D;  2QF7 A;  2F0U A;  3SR1 A;  5JOB A;  1E2W A;  1O80 A;  4KKS A;  4X3K A;  2IT1 A;  4BS9 A;  4FVM A;  1AZQ A;  4KJN A;  5CV8 A;  4OO1 I;  3ZYY X;  3RZO B;  1IHZ A;  5JPM C;  4FO2 A;  3NSW A;  3A8J E;  5IGF A;  1G2S A;  1EZ8 A;  2B2Y A;  1PZJ D;  2F0M A;  3WOF A;  5IT9 E;  2IL8 A;  2L55 A;  1JOQ A;  3K57 A;  4ZQ3 A;  3NQI A;  4JK1 C;  1LTT D;  3VYR A;  1KTK A;  1LT4 D;  4RAU C;  4AYB B;  4ZUI A;  3QWN A;  1QNU A;  1GHK A;  3RMH A;  1DZ1 A;  4NKL A;  1W6K A;  1SYC A;  1ML0 D;  3A8K E;  1SYE A;  1ILP A;  5I6W A;  3UI2 A;  3E0J A;  4H7B A;  4M8A A;  5FLX E;  3PO2 B;  2K28 A;  2K05 A;  2Z4H A;  3ND8 A;  5E4X A;  3P20 A;  2K7V A;  3QIA A;  2PYK A;  4B9X A;  2H1E A;  1QIL A;  3RZD B;  5EPJ A;  2RA4 A;  1TWC B;  5KRU A;  2K04 A;  1CFM A;  1D5Z C;  5ELF A;  4EQP A;  3C1F A;  5K36 H;  1HFG A;  2A6H C;  3ERQ A;  4DGZ A;  5M3F B;  3IFD A;  1R9T B;  2R61 A;  4KMU C;  3CRK C;  1FNV A;  1BBX C;  1TS2 A;  1PFN A;  1KLU D;  1LTS D;  2QCP X;  1GJX A;  3IAY A;  4KI0 A;  3A7L A;  2OT2 A;  3OMG A;  3H94 A;  2SNM A;  2WB1 B;  2EYJ A;  1JWM D;  1F9Q A;  1DOM A;  1I4G A;  1HUM A;  2VB3 X;  3MWY W;  4IUQ A;  3NBH A;  4PMC A;  4IUT A;  1AEX A;  5DNF A;  4K14 A;  1SEB D;  3SDZ A;  3JAM L;  2PO4 A;  1PRT B;  2KCN A;  4HCS A;  2B2V A;  3O13 A;  1H9S A;  2ENB A;  3DUZ A;  2M00 A;  3MXN A;  1WTW A;  4KTA A;  5KNB A;  3DXJ C;  2I46 A;  2WP8 J;  4TSS A;  5T1I A;  2MHV A;  3NBI A;  4U67 3;  4KK7 A;  3Q22 A;  3BVG A;  2A6E C;  3OIP A;  1JQY D;  4KKT A;  3L7Z C;  2MGS A;  3FPP A;  3D3R A;  2WV6 D;  1EL0 A;  2F0I A;  1JB3 A;  1E2Z A;  4DXG A;  1PRT F;  1PRT C;  3SK8 A;  1JWS D;  2ZT9 C;  1RTN A;  3GTQ B;  1MI2 A;  2KEC A;  3PUZ A;  4C3H B;  4XIG S;  5C3X A;  1WTX A;  2A6H D;  4DK0 A;  2KJX A;  2QIL A;  2O5I C;  3MC0 B;  1A3U A;  2NB0 A;  1ZKO A;  4BBS B;  1STY A;  3QB3 A;  5DEH A;  1ENF A;  1PDQ A;  1TY0 A;  3FDT A;  4WRD A;  1F2M A;  3KLS A;  3E6Z X;  3ONA B;  4IFD J;  2FMM A;  2F0H A;  1TS4 A;  1ESR A;  3P1H A;  1NSN S;  4HSV A;  4OO1 H;  4CGY B;  1SNO A;  4H13 C;  1ET6 A;  1U4P A;  1JR0 D;  3A7A B;  4XDX A;  5C4H A;  4ABN A;  2AQ1 B;  2XWJ B;  4BY1 B;  2KEE A;  5EPK A;  2EYP A;  3S1Q B;  3JAM E;  1G2T A;  3N6R A;  4XT1 B;  5A2Q L;  3D6W A;  2HUG A;  1WTV A;  2B8G A;  2R6G A;  1CT1 D;  3AMU A;  4F87 A;  4ZYS A;  5IGB A;  2E76 C;  1V43 A;  4IZ8 A;  5C5M A;  5JEA H;  3D4R A;  2VXW A;  1XTC D;  3J81 L;  4KY7 A;  1HFN A;  3EFX D;  1VF7 A;  2K5Q A;  1Q1B A;  1IW7 C;  1G29 1;  4ZAI A;  1SYB A;  3SVM A;  3BZD B;  4IUN A;  4NMZ A;  5JPN C;  2QDB A;  3BYT B;  5C0X G;  1PRT D;  1FD7 D;  1Y1W B;  1ENA A;  3BDC A;  5D14 A;  1D2B A;  3G7L A;  4K6D A;  2D2C C;  4HTH A;  1SNP A;  1EY9 A;  1V1O A;  3QJY A;  2ZXP A;  2MJ8 A;  1TWF B;  5KGU A;  1HA5 A;  1LT6 D;  1B9M A;  1D1K A;  1QOH A;  4IUU A;  5EBD A;  3C46 A;  2Y0S B;  1TT2 A;  3J80 L;  2XN9 C;  1M4V A;  2NN6 G;  2LY7 A;  3K5N A;  3L3O C;  4BA2 I;  3MHB A;  2OF1 A;  5AFW A;  3MXU A;  2VUM B;  1CZG A;  2HCC A;  1YNJ C;  1V8Q A;  3C3L A;  4K8I A;  3PUV A;  4BWG B;  1U4L A;  1RJT A;  4ME5 A;  2EYM A;  3VR4 A;  5CV6 A;  5J1Z A;  3H3V C;  5A2Q E;  1TWG B;  4FF1 A;  4TQU S;  3R3O A;  2G9D A;  4NW2 A;  5C4Z A;  5D65 A;  5I4D A;  2TSS A;  1RD9 D;  5LL6 X;  4G7Z C;  3J81 E;  1DCZ A;  2I07 B;  3I90 A;  2F0F A;  4C3H G;  3OW7 A;  1Y1V B;  3BVM A;  1IW7 D;  2WIN B;  3HGB A;  5CGK A;  1TWA B;  1UAP A;  2WKD A;  1EU3 A;  2FHT A;  1OXX K;  2E2I B;  2PW7 A;  1LTI D;  1XWE A;  2RKS A;  5JVG 3;  1U4M A;  1SJH D;  2B39 A;  2WAQ B;  2PQE A;  3DHQ A;  2KVM A;  4BBR B;  1TY2 A;  4C1N K;  4KD4 A;  1BOS A;  2NVT B;  4CKE A;  3C1E A;  3OPO A;  2F0Q A;  3GTM B;  4UAI A;  4RFB A;  2JSO A;  3MA2 B;  2C5C A;  2NTS A;  1WTO A;  4NDX A;  3VR3 A;  2L1B A;  4WJW A;  2DY7 A;  3J80 E;  2PZW A;  2KCC A;  1DM0 B;  1CK1 A;  4OIK A;  1WTQ A;  5ELB A;  3OWF A;  4G4K A;  2M9V A;  3NXW A;  5C3E B;  1TS3 A;  4DXF A;  1ZYR D;  2ICE C;  3V2T A;  1GXD C;  1QNK A;  1DYQ A;  3LWE A;  1PXU A;  4MIU A;  1MSG A;  2JA6 B;  3FKI B;  3OWE B;  1STA A;  1SDF A;  3VYT A;  1OXU A;  4QCL A;  3S17 B;  3CQZ B;  1I4R A;  1LTR D;  2XWB B;  1S5C D;  5HGT A;  2B2T A;  3WOE A;  3FVQ A;  5HUR A;  3R2T A;  1SMY C;  1EYD A;  1STN A;  1V1P A;  3VYS A;  1HUN A;  5EJW A;  3A8I E;  5LL6 S;  2HQE A;  1GHJ A;  3MFG A;  3SHL A;  2L4N A;  3S2H B;  4MN3 A;  3D31 A;  1X3Q A;  1FYC A;  3X3M A;  3SEB A;  2FJ2 A;  1ET9 A;  4RHR A;  4ZKB B;  1HCZ A;  3R8B A;  4L8J A;  1LTA D;  1Z47 A;  1RDP D;  4GZY C;  2JEB I;  1AW7 A;  2QEJ C;  3FEW X;  5CR3 A;  2M2L A;  1Q12 A;  3LX0 A;  2NZ1 D;  2F0W A;  2F03 A;  2F0P A;  1D6E C;  2B2U C;  1EU4 A;  3FMC A;  3PUW A;  2E2J B;  4OO1 G;  4ILW A;  1X32 A;  1Y69 U;  1WD1 A;  1ROD A;  1H9K A;  4X3S A;  1U4R A;  2JYO A;  2TMP A;  4Q5V A;  1EY5 A;  5ISR A;  4HSP A;  2ZXR A;  5FKA C;  1HHV A;  4A3G B;  4KHV A;  3U9S A;  1ESF A;  4H44 C;  4C3I B;  2AWN A;  5KNC A;  2A73 B;  1WD0 A;  2RDF A;  2AUJ D;  4DK1 A;  4V19 0;  3K58 A;  1CHP D;  4G7H C;  1S5E D;  3VR2 A;  3DMU A;  3TDQ A;  1SXT A;  1Z6H A;  2J0T D;  2SDF A;  3GTK B;  1S5D D;  2BA1 A;  2F0E A;  1IKL A;  1LTB D;  4IFD G;  1YNN C;  3OOC A;  1JOK A;  5IGE A;  2Q8R E;  4H0L C;  1I4X A;  3GQB A;  1STE A;  1TVX A;  4FYD A;  3HZX A;  3NWS A;  3PIP 3;  2EJG C;  2KOL A;  5JAV A;  1GOZ A;  4HN7 A;  1SMY D;  4CKB A;  4K5V A;  3A54 A;  2XRQ D;  3Q24 A;  2BDN A;  1KDC A;  3I91 A;  2K6A A;  1AP0 A;  1Q90 A;  1JC7 A;  4KD3 A;  4NP5 A;  3GD7 A;  3MTS A;  4R8I A;  2C9O A;  2EDG A;  5KYL A;  2EOT A;  2E2H B;  3T4A C;  1B9N A;  1BUV T;  3CU7 A;  1H9M A;  3QG1 A;  1SNM A;  4KN7 C;  4QB4 A;  2O2L D;  5DAU A;  4QF4 A;  3Q0A A;  1L0X B;  1NCV A;  5FO9 B;  1CI3 M;  4A3K B;  4XT3 B;  1WTP A;  1GUG A;  4OIJ A;  4XQJ A;  1QWY A;  3BVZ A;  4IN3 A;  2IX1 A;  3KBG A;  3VR6 A;  1Y8N B;  3D4D A;  1Q1E A;  4FNF A;  3AB9 A;  4K8J A;  3HOZ B;  2RSO A;  3HEJ A;  2EY5 A;  4RH6 A;  1JOO A;  2HCI A;  4DNT B;  2XNA C;  2L9H A;  2PNR C;  1YNN D;  1FR3 A;  2CVR A;  4FF2 A;  2AUK A;  2KUM A;  2F0S A;  3C2P A;  1Y8O B;  1VF5 C;  1G8Z D;  3MXP A;  1DOL A;  1F9R A;  5EGT A;  4KN4 C;  1TS5 A;  1PZI D;  4CJ0 B;  2QKI C;  3MEH A;  1HRJ A;  1LAC A;  3G6J B;  1MGS A;  3PO3 B;  4A93 B;  3EVQ A;  2A68 C;  1HA6 A;  3H0G B;  1NAP A;  4DNR B;  1VMC A;  3M7N A;  3TZD A;  1IYV A;  3I72 A;  4CKC A;  4RGO S;  1KAA A;  5I2Y A;  4R9W A;  1MD2 D;  3VA5 A;  4C3J B;  3S1N B;  3HOX B;  4G57 A;  4C3I G;  1K83 B;  1OO9 B;  4KJO A;  5JEA J;  1CA6 A;  1BDO A;  3MVV A;  4M1U B;  2JA7 B;  1PTO H;  4DFA A;  3S16 B;  1EY8 A;  1TU2 B;  3GO5 A;  3RD4 A;  4FXD A;  2MP1 A;  1JCK B;  1EQT A;  4XXE A;  1PLF A;  4DAY A;  4J8Q A;  3T53 B;  3R93 A;  2IX0 A;  1G91 A;  3PUY A;  3S15 B;  5CC4 A;  3QOL A;  4DAV A;  1JOR A;  2RVL A;  3I4N B;  3M4O B;  5I9P A;  2Z1C A;  2JP1 A;  5M3M B;  1TR5 A;  4X3U A;  5KYI A;  1FNU A;  1SYD A;  3I70 A;  2D5D A;  3CRL C;  1TWH B;  5TSS A;  4L63 B;  2E2D C;  3V05 A;  4K2L A;  1PFB A;  2V4D A;  1ZXT A;  3TP6 A;  1X3P A;  2F3W A;  2A6E D;  5ELD A;  3PUX A;  1RKN A;  4WFN 3;  4LK1 C;  3HKZ B;  2RDG A;  1VDZ A;  5EKK A;  4WOR A;  3K5M A;  2K32 A;  1GUS A;  2B8F A;  2O5J C;  2O4X A;  2D62 A;  3NE5 B;  3RLF A;  4RGT A;  3OSO A;  1C4Q A;  5EBC A;  3S1M B;  4HAE A;  2A68 D;  1RCV D;  3NP8 A;  4A3D B;  1BO0 A;  1GUT A;  2F0D A;  3FPU B;  4BA1 I;  3CHB D;  1F2Y A;  2L0C A;  4RCN A;  1D5M C;  3DWA A;  2B2W C;  3EQL C;  4DA2 A;  4TRD A;  1SYF A;  1E2V A;  1SE3 A;  3TP8 A;  3DWQ A;  5M5W B;  1D1I A;  4A3F B;  3K7A B;  5BN4 A;  1LO5 D;  1Q8I A;  3ERO A;  2DN8 A;  4K2K A;  3S9W A;  3KLR A;  3K5O A;  2F3V A;  1II3 A;  3DM1 A;  4E6I A;  2H4O A;  1KNE A;  2RDH A;  3K6O A;  1A6X A;  3NWT A;  1EIG A;  1CQV A;  2EY1 A;  3TP5 A;  1F77 A;  4J6H A;  4A3M B;  5EPL A;  4K6L A;  4FXG C;  2NTT A;  5CV9 A;  4F7X A;  2F0T A;  2AQ2 B;  1WVL A;  1ICW A;  2AWO A;  2OXP A;  3M3Y B;  1PTO C;  1SYG A;  1JWU D;  1QB5 D;  2CQA A;  3IKJ A;  1RF2 D;  4O42 A;  1STG A;  5K36 G;  4C3J G;  5DM7 3;  5F2D A;  1BCP B;  1PMR A;  2F0G A;  1J8I A;  4KY6 A;  4RGN A;  1EYC A;  1F2Z A;  2NYZ D;  4I65 A;  1F9P A;  3HRZ C;  2JEA I;  3W3A A;  3T56 B;  2F0L A;  1SBB B;  3FRP B;  2R93 B;  3NK9 A;  3F2U A;  5COY A;  1IKM A;  4KKU A;  2PW5 A;  4S3S A;  2F4I A;  2NWG A;  3M7G A;  1I3Q B;  1EWC A;  5C4J B;  2PZU A;  1QG7 A;  1BCP F;  2PCF B;  1BCP C;  4KY5 A;  4PMB A;  4HED A;  3HG9 A;  2JA8 B;  2NBF A;  3S14 B;  4ODG A;  2E75 C;  1TKW B;  4A3B B;  1T5X D;  2LMC B;  4ZK9 B;  3TME A;  4XTC S;  4XQQ A;  1BR9 A;  1YNJ D;  1IYU A;  1H9J A;  4RHS A;  4B08 A;  2JXM B;  3QOJ A;  1AN8 A;  1PFM A;  3SXH A;  1B4O A;  4EVO A;  2F1M A;  1DOK A;  3OHX C;  5IOD A;  3BYY B;  3IFT A;  4I7Z C;  4IUR A;  4MHE A;  1BQQ T;  1IL8 A;  3AU7 A;  3HP3 A;  2IW3 A;  4QMG A;  2K5W A;  1STB A;  2NVY B;  4DF7 A;  1S5F D;  2Q8I B;  4ZUJ A;  2Q8T A;  3BDL A;  3URY A;  3MXG A;  2EJF C;  2F0J A;  2BCO A;  2SEB D;  1S5B D;  3PIO 3;  2RSN A;  1SE2 A;  1O7L A;  5BN3 A;  5CMD A;  3SK6 A;  4C2M B;  1T5E A;  1I6H B;  4RA8 A;  5M5Y B;  2IX3 A;  4OHJ A;  2YU9 B;  2XRS D;  4KHZ A;  2B2Y C;  3BS1 A;  5FOB B;  5J39 A;  1RHP A;  1LV9 A;  1EY4 A;  2LS0 1;  5CV4 A;  5C0X H;  4PMW A;  1K8M A;  3HOU B;  5ELE A;  4V0B A;  1EFI D;  4ZLT F;  2XIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...